SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSDORP00000011939 from Dipodomys ordii 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSDORP00000011939
Domain Number 1 Region: 6-186
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 1.78e-57
Family G proteins 0.000000016
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSDORP00000011939   Gene: ENSDORG00000012695   Transcript: ENSDORT00000012695
Sequence length 218
Comment pep:novel genescaffold:dipOrd1:GeneScaffold_245:4348:17273:1 gene:ENSDORG00000012695 transcript:ENSDORT00000012695 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MTDGDYDYLIKLLALGDSGVGKTTFLYRYTDNKFNPKFITTVGIDFREKRVVYNTQGPNG
SSGKAFKVHLQLWDTAGQERFRSLTTAFFRDAMGFLLMFDLTNQQSFLNVRNWMSQLQAN
AYCENPDIVLIGNKADLPDQREVNERQARELAEKYGIPYFETSAATGQNVEKSVETLLDL
IMKRMEQCVEKTQVPDAVNGGNSGKLDGEKTVERKCAC
Download sequence
Identical sequences A0A1S3FD13
ENSDORP00000011939 XP_012874371.1.60039 ENSDORP00000011939

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]