SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSDORP00000011949 from Dipodomys ordii 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSDORP00000011949
Domain Number 1 Region: 461-516
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 3.28e-20
Family Classic zinc finger, C2H2 0.0054
Further Details:      
 
Domain Number 2 Region: 521-567
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0000000000957
Family Classic zinc finger, C2H2 0.0069
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSDORP00000011949   Gene: ENSDORG00000012706   Transcript: ENSDORT00000012706
Sequence length 652
Comment pep:novel scaffold:dipOrd1:scaffold_13197:20752:26955:-1 gene:ENSDORG00000012706 transcript:ENSDORT00000012706 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MFLKAGRGKKVPPVRVCGPDCIVMMEPPLSKRTPPALRLADLATAQAQPLQNMTGFPVLA
SPPAHSQLRAAAAHLHPRDLGADPGVAVTLLRPEHMAQASAQSLGPPSQALSVQPEAPAA
ADCTAALLAHPSADTYPRGGSGGARSSAPQSRTLPLSXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXQPIKQEIICKWIDPDELTGPPPPPPPPAGGAC
SKTLGTMHELVNHVTVEHVGGPEQSSHVCFWEDCPREGKPFKAKYKLINHIRVHTGEKPF
PCPFPGCGKVFARSENLKIHKRTHTGEKPFKCEFDGCDRKFANSSDRKKHSHVHTSDKPY
YCKIRGCDKSYTHPSSLRKHMKIHCKSPPPSPGTLAYSAVGTPVGAPLSPVLDPARSRSS
TLSPQVTNLNEWYVCQATGAPSHLHTPSSNGTTSESEDEEMYGNPEAVRTIH
Download sequence
Identical sequences ENSDORP00000011949 ENSDORP00000011949

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]