SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSDORP00000012187 from Dipodomys ordii 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSDORP00000012187
Domain Number 1 Region: 400-456
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1e-23
Family Classic zinc finger, C2H2 0.0062
Further Details:      
 
Domain Number 2 Region: 512-568
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 2.08e-23
Family Classic zinc finger, C2H2 0.0066
Further Details:      
 
Domain Number 3 Region: 455-512
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.61e-21
Family Classic zinc finger, C2H2 0.006
Further Details:      
 
Domain Number 4 Region: 343-400
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 8.03e-21
Family Classic zinc finger, C2H2 0.0064
Further Details:      
 
Domain Number 5 Region: 235-288
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.94e-19
Family Classic zinc finger, C2H2 0.0037
Further Details:      
 
Domain Number 6 Region: 288-344
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 2.22e-19
Family Classic zinc finger, C2H2 0.0069
Further Details:      
 
Domain Number 7 Region: 557-609
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 5.85e-16
Family Classic zinc finger, C2H2 0.0069
Further Details:      
 
Domain Number 8 Region: 195-246
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0000000000000274
Family Classic zinc finger, C2H2 0.012
Further Details:      
 
Weak hits

Sequence:  ENSDORP00000012187
Domain Number - Region: 83-125
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0337
Family Classic zinc finger, C2H2 0.03
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSDORP00000012187   Gene: ENSDORG00000012963   Transcript: ENSDORT00000012963
Sequence length 611
Comment pep:novel scaffold:dipOrd1:scaffold_13686:502:2388:-1 gene:ENSDORG00000012963 transcript:ENSDORT00000012963 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
CWCEAEAGEALSEKHVSVEGVSPVRSPDADNACLREDWEPLLEHTVCLAEHQDSPCTHCL
CGKGFCWHQKRNCGENSFRPCRNLLVRSCVVHTVRTPFSCREAGMAVQSSSSLLSHLTAQ
SGGKPSPDGLGQQHEDRNRQVLSTSRGDERAMQGSVLLDSQTARSDMRPVRCLPGVMAFK
EESTPSDRGVPGRTPHVCEECGKAFARPSHLKIHQKCHTRKAHYTCSDCGKTVSRKDLLI
QHRRIHTGERPFECRECGKAFRRKHLVQHQRFHTGERPYKCAECGKFFSHSSHLIEHCRI
HTGARPYQCVECGKFFSHKSSFLKHQSVHSGVRSYVCSQCGKAFGCKDTLVQHETVHTGA
RPYRCTQCGKAFSRKDTLSKHRKIHTGERPYECHECGKLFRRSSNLIEHQRIHTGAKPYE
CNKCGKCFSHKSTLILHQRVHTGARPYVCNDCGKAYICSSHLIQHKKVHTGARPYGCTQC
GKAFSSRNTLAKHRKIHTGERPYECGECGKLFRQSSNLMVHQRIHTGAKPYECNKCGKCF
SHKTTLILHLRVHTGTRPYVCDECGKAYVSSYHLVQHKKVHTGTRSYECNQCRKLFRCNS
SLVLHQRVHTG
Download sequence
Identical sequences ENSDORP00000012187 ENSDORP00000012187

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]