SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSDORP00000012188 from Dipodomys ordii 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSDORP00000012188
Domain Number 1 Region: 167-224
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.49e-24
Family Classic zinc finger, C2H2 0.0038
Further Details:      
 
Domain Number 2 Region: 83-140
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 4.38e-24
Family Classic zinc finger, C2H2 0.0057
Further Details:      
 
Domain Number 3 Region: 5-56
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 9.34e-20
Family Classic zinc finger, C2H2 0.0041
Further Details:      
 
Domain Number 4 Region: 209-254
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0000000000112
Family Classic zinc finger, C2H2 0.0041
Further Details:      
 
Domain Number 5 Region: 130-161
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.000000000468
Family Classic zinc finger, C2H2 0.01
Further Details:      
 
Domain Number 6 Region: 46-77
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00000000167
Family Classic zinc finger, C2H2 0.0091
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSDORP00000012188   Gene: ENSDORG00000012964   Transcript: ENSDORT00000012964
Sequence length 293
Comment pep:novel scaffold:dipOrd1:scaffold_13686:12885:13764:-1 gene:ENSDORG00000012964 transcript:ENSDORT00000012964 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
RDRPGFIRHYIIHSGENPYECFECGKFFKHRSYLMWHQQTHTGEKPFECSECGKVFCESA
ALIHHYVIHTGEKPFECLQCGKAFNHRSYLKRHQRIHTGEKPYVCSECGKAFTHCSTFIL
HKRAHTGEKPFACKECGKAFSNRADLIRHFSIHSGEKPYECMECGKAFNRRSGLTRHKRI
HSGEKPYECIECGKSFCWSTNLIRHAVIHTGEKPYECGQCGKAFSRSSSLCQHQKKHRGR
NPASVAGGGRTFTSGQTSVDIQELLLRNDFLNVSVEGNRLQATDHSYQRETLS
Download sequence
Identical sequences ENSDORP00000012188 ENSDORP00000012188

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]