SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSDORP00000012196 from Dipodomys ordii 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSDORP00000012196
Domain Number 1 Region: 407-451
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 3.04e-16
Family Classic zinc finger, C2H2 0.0039
Further Details:      
 
Domain Number 2 Region: 440-478
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0000000000761
Family Classic zinc finger, C2H2 0.0052
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSDORP00000012196   Gene: ENSDORG00000012974   Transcript: ENSDORT00000012974
Sequence length 511
Comment pep:novel scaffold:dipOrd1:scaffold_48993:1250:12353:1 gene:ENSDORG00000012974 transcript:ENSDORT00000012974 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MHAPGSAGPGDARAXXXXXXXXXXXXXXXXXXXXXXXXXXXQTDIEAVEALVCMSSWGQR
VQKGDLLKMRPLTPISDSGDVSNSVLMDATVPELPKDFHSFSTLXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXPACFPATQAHEQRSATGREGAARSARRAEALADAHLAADVLSTNFLSCQPHLHSLEDM
LPASQGQQARWPAAAQACSPKKVENDLPRKNTPVVSIPVASPPVLCQMIPMSGPSTVLSA
ILKPPLLPSSGTVKPILPQATPAPPQVLVGPPVPQGSVMLVLPQATFPQPAACPSSVVAI
GNTKLLPLAPAPVFIASSPNCAPQVDFSRRRNYICSFPGCRKTYFKSSHLKAHLRTHTGE
KPFTCSWDGCDKKFARSDELSRHRRTHTGEKKFVCPVCDRRFMRSDHLTKHARRHMTTKK
IPGWQAEVGKLSRIASAEGPGSPPPPLPASA
Download sequence
Identical sequences ENSDORP00000012196 ENSDORP00000012196

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]