SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSDORP00000012228 from Dipodomys ordii 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSDORP00000012228
Domain Number 1 Region: 190-247
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.57e-24
Family Classic zinc finger, C2H2 0.0054
Further Details:      
 
Domain Number 2 Region: 120-172
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.33e-19
Family Classic zinc finger, C2H2 0.0036
Further Details:      
 
Domain Number 3 Region: 232-284
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 9.3e-18
Family Classic zinc finger, C2H2 0.0078
Further Details:      
 
Weak hits

Sequence:  ENSDORP00000012228
Domain Number - Region: 280-299
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00596
Family Classic zinc finger, C2H2 0.017
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSDORP00000012228   Gene: ENSDORG00000013008   Transcript: ENSDORT00000013008
Sequence length 308
Comment pep:novel scaffold:dipOrd1:scaffold_76810:7:6849:-1 gene:ENSDORG00000013008 transcript:ENSDORT00000013008 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
PSICKPDMNVLLDEEGKEPSTVVKEGTRRYSPDWESRYNANTSSPERDIYEIFSLQWEIM
ERMKSYSLQGSIFRHDWACKSKTEEQKEQEESYLGQVKLTSGKVTTYKKHSFLTDYPRVH
NGEKLYECKECQKTFIRRSTLSQHLRIHTGEKPYKCKVCGQPFRQRAHLIRHHKLHTGEK
PYECKECGKAFTVLQELTQHQRLHTGEKPYECKECGKAFRVHQQLARHQRIHTGEKPYEC
KDCGKTFRQCTHLTRHQRLHNSEKLYECKECGKAFVCGPDLRVHQKIHFGEKPYACDCGR
FRICQQLT
Download sequence
Identical sequences ENSDORP00000012228 ENSDORP00000012228

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]