SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSDORP00000012242 from Dipodomys ordii 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSDORP00000012242
Domain Number 1 Region: 178-235
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 3.39e-24
Family Classic zinc finger, C2H2 0.003
Further Details:      
 
Domain Number 2 Region: 234-289
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 2.19e-22
Family Classic zinc finger, C2H2 0.0037
Further Details:      
 
Domain Number 3 Region: 295-347
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 4.97e-19
Family Classic zinc finger, C2H2 0.0074
Further Details:      
 
Domain Number 4 Region: 140-192
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 8.75e-19
Family Classic zinc finger, C2H2 0.0042
Further Details:      
 
Domain Number 5 Region: 346-402
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0000000000000055
Family Classic zinc finger, C2H2 0.01
Further Details:      
 
Domain Number 6 Region: 387-439
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0000000000000173
Family Classic zinc finger, C2H2 0.0057
Further Details:      
 
Domain Number 7 Region: 75-120
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0000598
Family Classic zinc finger, C2H2 0.031
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSDORP00000012242   Gene: ENSDORG00000013021   Transcript: ENSDORT00000013022
Sequence length 519
Comment pep:novel scaffold:dipOrd1:scaffold_70464:332:2044:1 gene:ENSDORG00000013021 transcript:ENSDORT00000013022 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
SQTKKLFQKNSASDTEVCQWEVLEICRNHSLRGLCFRGDGAELNQLHRQHENHQKYFKSS
TVTCEKVSTSNLNEAYNQHQQLNAEEGPNEFKRTFNSASDHSQHRTVHTGKKTYKNKECD
TTLSFFSGVPGPKRIHSEEKHHKCKECGKAFSLDSDLTQHQRSHTGEKPYECKQCGKAYS
RKADLIGHQRIHTGEKPYQCKECGKAFTRGSYLTEHQRIHTGEKPYECTECSRAFVQRAH
LTNHQRIHTGEKPYECKECGKAFTRGSHLSEHQKIHDGEKLHECKECGKACIHGSGVSDH
QNAHVGRKPYECEKCGKAYIWSSNLARHQRSHTGRKPYECKHCGKTFIWASYLAQHEKVH
EKKLYECKECGKTFLQGSDFNRHQKIHKSERMNACKECGKTFGHRSELDQHEKTHTGKRP
YECEDWGKAFLWGSQLTRHMYVSRELGNEFEKPFVNPLTCRKVPTDADDCSFTEGKKNHN
GEAGYGNIFHYRLYFVIHQNIYAFKSYEYKDKCHVVSIL
Download sequence
Identical sequences ENSDORP00000012242 ENSDORP00000012242

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]