SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSDORP00000012272 from Dipodomys ordii 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSDORP00000012272
Domain Number 1 Region: 11-114
Classification Level Classification E-value
Superfamily ArfGap/RecO-like zinc finger 2.49e-33
Family Pyk2-associated protein beta ARF-GAP domain 0.0023
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSDORP00000012272   Gene: ENSDORG00000013057   Transcript: ENSDORT00000013056
Sequence length 519
Comment pep:novel genescaffold:dipOrd1:GeneScaffold_3875:117319:126768:-1 gene:ENSDORG00000013057 transcript:ENSDORT00000013056 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAAEPSKTEIQTLFKRLRAIPTNKACFDCGAKSPSWASITYGVFLCIDCSGVHRSLGVHL
SFIRSTELDSNWSWLQLCMQVGGNANATAFFRQHGCTANDANTKYNSRAAQMYREKIRQL
GSAALARHGTDLWIDNLSSAPSHSPEKKDSDFFTEHTHPPSWDAPATEPSGMQQPAPSAE
SSGLAQPELGPNTDLLGTSPKASLELKSSIIGKKKPAAAKKGLGAKKGLGAQKVSNQSFT
EIERQAQVAEKLREQQAADAKKQAEESMVASMRLAYQELQIDRKKEEKKLQNLEGKKREQ
AERLGMGLVSRSSVSHSVLSEMQVIEQETPVSAKSSRSQLDLFDDVGTFASGPPKYKDNP
FSLGETFGSRWDTDGAWGVDRVEEKEPEVTISSIRPVSERATNRREVESRSSGLESSEAR
QKFAGAKAISSDMFFGREVDSEYEARSRLQQLSGSSAISSSDLFGDMDGAHGGGSVSLGN
VLPTADIAQFKQGVKSVAGKMAVLANGVMNSLQDRYGSY
Download sequence
Identical sequences ENSDORP00000012272 ENSDORP00000012272

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]