SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSDORP00000012286 from Dipodomys ordii 69_1

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  ENSDORP00000012286
Domain Number - Region: 386-417
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00992
Family Classic zinc finger, C2H2 0.043
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSDORP00000012286   Gene: ENSDORG00000013070   Transcript: ENSDORT00000013070
Sequence length 510
Comment pep:novel genescaffold:dipOrd1:GeneScaffold_106:3010:16300:-1 gene:ENSDORG00000013070 transcript:ENSDORT00000013070 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
LHTKGFVQGSETTLQSTYSDTSAQPTCDYGYGTWNSGTNRGYESYGYGYGYGQDNATNYG
YGMATSHSWEMPSSDTNANPGASGGASADSVLSRINQRLDVVPHLETDVMQGSMYGSGGE
RYDSYEACDTRAVLGERDLYRSGYDYGDLDPEMEMAYEGQYDAYRDQFRMRGGDSFGPRA
QGWARDARSGRPMASGYGRMWEDPMGARGQCMPGASRLPSLFSQNIIPEYGMFQGMRGGG
AFPGGARFGFGFGDMKQMRRTWKTWTTVDFRXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXEGTEGEAAEGPEGTEPMEKGSREGEDEEGKEDGREDGKDESEKGALTSQDESSQAK
RKLQAAKKSQDKQKKRQRDRMVERIQFVCSLCKYRTFYEDEMASHLDSKFHKEHFKYVGT
KLPKQTADFLQEYVTNKTKKTEELRKTVEDLDGLIQQIYRDQDLTQEIAMEHFVRKVEAA
HCAACDLFIPMQFGIIQKHLKTMDHNRNRR
Download sequence
Identical sequences ENSDORP00000012286 ENSDORP00000012286

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]