SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSDORP00000012310 from Dipodomys ordii 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSDORP00000012310
Domain Number 1 Region: 1-68,105-160
Classification Level Classification E-value
Superfamily NAD kinase/diacylglycerol kinase-like 7.52e-18
Family NAD kinase-like 0.022
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSDORP00000012310   Gene: ENSDORG00000013100   Transcript: ENSDORT00000013096
Sequence length 279
Comment pep:novel genescaffold:dipOrd1:GeneScaffold_4747:77740:104386:-1 gene:ENSDORG00000013100 transcript:ENSDORT00000013096 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MLLAASKVLDRLKPVIGVNTDPDRSEGHLCLPVRYTHSFPEALQKFYRGEFRWLWRQRIR
LYLEGTGINPVPVDLHEQQLSLNQHSRAFNIERVDDERSEASGPQLLPVRALNEVFIGES
LSSRASYYEISLDDGPWEKQKSSGLNLCTGTGSKAWSFNINRVATQAVEDVLNIAKRQGN
LNLPLNKELVEKVTNEYNESLLYSPEEPKILFSIREPIANRVFSSSRQRCFSSKVCVRSR
CWDACMVVDGGTSFEFNDGAIASMMINKEDELRTVLLEQ
Download sequence
Identical sequences ENSDORP00000012310 ENSDORP00000012310

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]