SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSDORP00000012348 from Dipodomys ordii 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSDORP00000012348
Domain Number 1 Region: 39-146
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 6.02e-30
Family Spermadhesin, CUB domain 0.00036
Further Details:      
 
Domain Number 2 Region: 168-342
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 0.000000000000156
Family Pentraxin (pentaxin) 0.007
Further Details:      
 
Domain Number 3 Region: 856-1136
Classification Level Classification E-value
Superfamily Family A G protein-coupled receptor-like 0.00000000302
Family Rhodopsin-like 0.02
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSDORP00000012348   Gene: ENSDORG00000013134   Transcript: ENSDORT00000013134
Sequence length 1246
Comment pep:novel genescaffold:dipOrd1:GeneScaffold_1814:18279:137860:1 gene:ENSDORG00000013134 transcript:ENSDORT00000013134 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MFDSGGLWSYHWKWKPSPLLILLGLCVICTPHSVWGCSSCRLVLSNPSGTFTSPCYPSDY
PNIQACMWTLRAPTGYIIQITFNDFDIEEAPGCIYDSLSLDNGERETKFCGATAKGLSFN
SSANEMHVSFSSDFSIQKKGFSASYIRVAVSLRNQKVILPQTVDAYQISVAKSVSIPELS
AFTLCFEATKVGKDDSDWLAFSYSDASFTQLLSLGKVNNNYFLTISGSKCFLNSVLPVKD
KGGIFTESFEQLCIVWNNTQGTVGVSFKRNYETVPCDSTISTAIPGKGKLLLGSNRNEIA
SLKGDIYNFRLWNFTMNPKLLSNLSCNEKGNVIDWQNEFWNIPTVALKAENNLSCGSYLI
PHPVAELTNCIDLGTLCQATVNASSTPEPIVTTNMPVTNRHDKPMNXXXXXXXXXXXXXX
XXXXXXXXXXKVAEWLNSTFQNWNYTVYVVNISFHLSTSEDKTKVKRSLVDDQXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXYRNNSNLSVAYWGPLVLSECSMEANQVANQILNLTADGQNL
TSANINNIVEQVKRLVSKEENIDLTLGSMLINIFSNILSSSDGDLFESSSEALKTIDELA
FKIDLNSTPRVNIATKNLALGVSALTPGTSVISNFSIGLPSNNESYFQMDFENGQMDPLA
SVVLPPNLLENLSQEDLMLVTRAQFTFFNKTGLFQDVEPQSKALVSYVMACSIGNITIQN
LKDPVQIRIKHTRTQEVRHPICAFWDLNKNKSFGGWNTSGCIAHTDSDASETICLCNHFT
HFGVLMDLPRSASQMDSRNTKVLTFITYMGCGVSAIFSAATLLTYVAFEKLRRDYPSKIL
MNLSSALLFLNLIFLLDGWITSFGVDGLCTAVAALLHFFLLATFTWMGLEAIHMYIALVK
VFNTYIRRYILKFCIIGWGLPALVVSIILTSRKQNEVYGKDSYGKEQGDEXXXIQDAVIF
YVTCAGFGVMFFLNAMFVVMVQICGRNGKRSNRTLKEEVLRNLRSVVSLTFVLGMTWGFA
FFAWGPLNIPFMYLFSIFNSLQGLFIFIFHCAMKENVQKQWRRHLCCGRFRLADNSDWSK
TATNIIKKSSDNLGKSLSSSSIGSNSTYLTSKSKSSCTTYFKRDSNTDSASMEKSLSKLA
HGDGEQTSIIPVHQVIDKVKGYCNAHSDNFYKNIIMSDTFSHSTKF
Download sequence
Identical sequences ENSDORP00000012348 ENSDORP00000012348

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]