SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSDORP00000012361 from Dipodomys ordii 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSDORP00000012361
Domain Number 1 Region: 313-369
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 5.74e-21
Family Classic zinc finger, C2H2 0.0049
Further Details:      
 
Domain Number 2 Region: 109-169
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 4.56e-19
Family Classic zinc finger, C2H2 0.0054
Further Details:      
 
Domain Number 3 Region: 191-243
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 5.76e-19
Family Classic zinc finger, C2H2 0.0049
Further Details:      
 
Domain Number 4 Region: 451-503
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.33e-18
Family Classic zinc finger, C2H2 0.0046
Further Details:      
 
Domain Number 5 Region: 547-598
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 3e-17
Family Classic zinc finger, C2H2 0.0073
Further Details:      
 
Domain Number 6 Region: 274-326
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 6.88e-17
Family Classic zinc finger, C2H2 0.0057
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSDORP00000012361   Gene: ENSDORG00000013148   Transcript: ENSDORT00000013147
Sequence length 623
Comment pep:novel scaffold:dipOrd1:scaffold_9909:3903:9048:1 gene:ENSDORG00000013148 transcript:ENSDORT00000013147 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MERAVEPWGPNLRSPEERELPRGAGAALGSENVEVSQPDEFELQEEDDLGFKEEEDLAPA
HEVGTVSLKPEGIQTWDDLWVHKEGLGKPQPRDRAPRVLGEPRWGQGSGDRTAVCGECGK
SFRQMSDLVKHQRTHTGEKPYKCGVCGKGFGDSSARIKHQRTHSGEKPYRARPQTQGPPK
IPRPRIPAGERPTICGECGKSFRQSSDLVKHQRTHTGEKPYKCGICGKGFGDSSARIKHQ
RTHRGEQPPRPVVPRQQPSRATPTAAQGPKAQDKPYTCTDCGKRFILSCSLLSHQRSHLG
PKPFGCDVCGKEFARGSDLVKHLRVHTGEKPYLCPECGKGFADSSARVKHLRTHSGERPH
ACPECDRTFSLSSTLLRHRLTHMEPQDFGFAGYPVAPLISSPPPPPLGTSPSLTPRSPSH
SGDGPFGLPGFEPEPGGPQAGEPPPPLAGDKPHICPECGKGFRRSSDLVKHHRVHTGEKP
YLCPECGKGFADSSARVKHLRTHRGERARPPPPPPPSTLLRPHNPPGPAPTTPRPRVRAQ
PSGPSQPHVCGFCGKEFPRSSDLVKHRRTHTGEKPYKCAECGKGFGDSSARIKHQRGHLA
LRPFGIVDVQTRPLKEESPTGLE
Download sequence
Identical sequences ENSDORP00000012361 ENSDORP00000012361

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]