SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSDORP00000012381 from Dipodomys ordii 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSDORP00000012381
Domain Number 1 Region: 2-120
Classification Level Classification E-value
Superfamily POZ domain 1.1e-30
Family BTB/POZ domain 0.00088
Further Details:      
 
Domain Number 2 Region: 608-658
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0000000000000726
Family Classic zinc finger, C2H2 0.0088
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSDORP00000012381   Gene: ENSDORG00000013170   Transcript: ENSDORT00000013168
Sequence length 676
Comment pep:novel genescaffold:dipOrd1:GeneScaffold_3817:170004:172034:-1 gene:ENSDORG00000013170 transcript:ENSDORT00000013168 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MDFPGHFEQIFQQLNYQRLHSQLCDCVIVVGNRHFKAHRSVLAACSTHFRALFSVAEGDQ
TMNMIQLDSEVVTAEAFAALIDMMYTSTLMLGESNVMDVLLAASHLHLNSVVKACKHYLT
TRTLPMSPPSERVQEQSARMQRSFMLQQLGLSIVSSALSSSQGVEEPPAPISSSMRSNLD
QRTPFPMRRLHKRKQSAEERARQRLRPALDEAAVSDVAPEAGPGGVHSREEFFSPDSLKM
VENPKPDGMTDSQEDGGILFDQSFGAQEDAQVPSQSDNTASNMAQLSMASRATQVETSFE
QEAAAEKSGFPCENPEVGLGEKEHMRVVVKSEPLSSPEPQDEVSDVTSQAEGSESVEVEG
VAVSAEKIDLSPESSDRSFSDPQSSTDRVGDIHILEVTNNLEHKSTFSISNFLNKSRGSN
FSTSQSNDDNIPNTTSDCRLEGEAPYLLSPEAGPPGGPSSAPGSHVENPFSEPADSHFVR
PMQEVMGLPCVPTSGYQGEQFGMDFSRSGLGLHSSFSRVMMGSPRGGASNFPYYRRIAPK
MPVVTSVRSSQIPENSASSQLMMNGATSSFENGHPSQPGPPQLTRASADVLSKCKKALSE
HNVLVVEGARKYACKICCKTFLTLTDCKKHIRVHTGEKPYACLKCGKRFSQSSHLYKHSK
TTCLRWQSSNLPSTLL
Download sequence
Identical sequences A0A1S3G133
ENSDORP00000012381 ENSDORP00000012381 XP_012882008.1.60039 XP_012882009.1.60039

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]