SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSDORP00000012483 from Dipodomys ordii 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSDORP00000012483
Domain Number 1 Region: 321-377
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.48e-23
Family Classic zinc finger, C2H2 0.0082
Further Details:      
 
Domain Number 2 Region: 237-293
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.92e-23
Family Classic zinc finger, C2H2 0.0072
Further Details:      
 
Domain Number 3 Region: 376-433
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 7.56e-20
Family Classic zinc finger, C2H2 0.0051
Further Details:      
 
Domain Number 4 Region: 198-250
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.91e-19
Family Classic zinc finger, C2H2 0.0057
Further Details:      
 
Domain Number 5 Region: 500-552
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 5.31e-17
Family Classic zinc finger, C2H2 0.0069
Further Details:      
 
Domain Number 6 Region: 418-470
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 9.44e-17
Family Classic zinc finger, C2H2 0.0098
Further Details:      
 
Domain Number 7 Region: 283-315
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.000000000746
Family Classic zinc finger, C2H2 0.0079
Further Details:      
 
Domain Number 8 Region: 153-209
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.000000833
Family Classic zinc finger, C2H2 0.02
Further Details:      
 
Weak hits

Sequence:  ENSDORP00000012483
Domain Number - Region: 479-508
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.000357
Family Classic zinc finger, C2H2 0.019
Further Details:      
 
Domain Number - Region: 3-26
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0984
Family Plant C2H2 finger (QALGGH zinc finger) 0.068
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSDORP00000012483   Gene: ENSDORG00000013277   Transcript: ENSDORT00000013276
Sequence length 556
Comment pep:novel scaffold:dipOrd1:scaffold_28647:2396:4070:1 gene:ENSDORG00000013277 transcript:ENSDORT00000013276 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
SMPETQRCTSCPLLFSSQQALSQHMWQSPLSQLFPSLCAGTHCFPWKHYLEDLKQWQEQF
FDQDGLRNKAETQEQEQESRLLFGSLSRSDSSKPISTLPEEYLVRPKEDGPMMDTSSSLE
LKVDLEETATKLFHGLTVSQFGVLKYEKLGPRFMKESNLPSLQKTHPRETSFIGTKWGQS
LSRLPVLMKNPKTHVGDKPFLCQECGRGFTWKSNLITHQRMHSGEKPFVCKDCGRGFTWK
SNLFTHQRIHSGVKPYMCQECGQSFSLKSNLITHQRSHTGEKPYVCKECGSGFRQHSHLI
RHKRTHSGEKPFVCRECQQRFSQKSHLVRHLRTHTGEKPYICTECGRGFSWKSNLLTHQR
THSGVKPYVCLECGQSFSLKSNLSKHQKAHAGEKPFGCTECGRSFTRKSSLVTHQKKHSG
EKLFVCRECKRSFNDKLTLHTHQRIHSGEKPFMCRECGQRFRQKPNLFRHKRAHSGDSVC
RECGQGFCDKLTLIKHERAHSGNKVHMCRECGQGFSRQSHLLRHQRTHSGEKPYICRKCA
RAFSRKSNLLRHQRTI
Download sequence
Identical sequences ENSDORP00000012483 ENSDORP00000012483

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]