SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSDORP00000012508 from Dipodomys ordii 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSDORP00000012508
Domain Number 1 Region: 3-95
Classification Level Classification E-value
Superfamily POZ domain 8.05e-23
Family BTB/POZ domain 0.0066
Further Details:      
 
Domain Number 2 Region: 358-406
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0000000000092
Family Classic zinc finger, C2H2 0.014
Further Details:      
 
Domain Number 3 Region: 251-278
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.000000706
Family Classic zinc finger, C2H2 0.022
Further Details:      
 
Domain Number 4 Region: 442-467
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0000425
Family Classic zinc finger, C2H2 0.025
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSDORP00000012508   Gene: ENSDORG00000013305   Transcript: ENSDORT00000013304
Sequence length 512
Comment pep:novel genescaffold:dipOrd1:GeneScaffold_2685:39217:46389:-1 gene:ENSDORG00000013305 transcript:ENSDORT00000013304 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MDLTNHGLILLQQLNAQREFGFLCDCTVAIGDVYFKAHKSVLASFSNYFKMLFVHQTSEC
VRLKPTDIQPDIFSYLLHLMYTGKMAPQLIDPVRLDQGIKFLHAYPLIQEASLASQGTFS
HPDQVFPLASSLYGIQIADHQLRQASKIASAPEKLGREPRPPPARMSREPVPEAPQLSQL
TSNLAQVNRTNMTPADPLQTSLSPELVSTPVPPPPPGEETNLEASSSDEHPAALTIAHVK
PSIMKRNGSFPKYYACHLCGRRFTLRSSLREHLQIHTGVPFTSSQPGESRVPLSLCTNAA
DLGKDSMEVPEAGMISDSELQHISDSPIIDGQQQSETPPPSDIADIDIEADQEREVKRRK
YECTICGRKFIQKSHWREHMYIHTGKPFKCSTCDKSFCRANQAARHVCLNQSIDTYTMVD
KQTLELCTFEEGSQMDNMLVQTNKPYKCNLCDKTFSTPNEVVKHSCQNQGSDVFALEEGR
SVLLGGGDSEVTEPDHPVLASIKKEQETVLLD
Download sequence
Identical sequences ENSDORP00000012508 ENSDORP00000012508

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]