SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSDORP00000012597 from Dipodomys ordii 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSDORP00000012597
Domain Number 1 Region: 411-465
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 9.59e-18
Family Classic zinc finger, C2H2 0.0018
Further Details:      
 
Domain Number 2 Region: 458-485
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0000000448
Family Classic zinc finger, C2H2 0.0041
Further Details:      
 
Domain Number 3 Region: 363-393
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.000000595
Family Classic zinc finger, C2H2 0.0074
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSDORP00000012597   Gene: ENSDORG00000013398   Transcript: ENSDORT00000013398
Sequence length 792
Comment pep:novel genescaffold:dipOrd1:GeneScaffold_1522:109893:284944:-1 gene:ENSDORG00000013398 transcript:ENSDORT00000013398 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
ALGFGPQCKSIGKGSCNNLVVTSSPMMVQRLGPSPPASQVSTACXXXXXXXXXXXXXXXX
XXXXXXXXSLTSRDSVASTTLSLTESHSALSVKQEWSQGYRPLPSLASSHGSQNGVDLGD
LFSLPPGTSMSSHSASNSLPSYIFGMENSHSHYPSPRHSSTRSHSARSKKRALSLSPLSD
GIGIDFNTIIRTSPTSLVAYINGSRASPAHVSPQPEVYGHFLGVRGSCIPQPCAVPGGQK
GVLVAYGENGAPEYERMQQLEHGGLQPGQVTNMVVQHGLPGPDGQQAGMLKTERLEEFPG
STLDLPSAPPLAPLPPPQGPPPPYHAHPHLHHPPELLPHAHTLALPQAALDEDGEMEDLG
GKHCCRWIDCSALYDQQEELVRHIEKVHIDQRKGEDFTCFWAGCPRRYKPFNARYKLLIH
MRVHSGEKPNKCTFEGCKKAFSRLENLKIHLRSHTGEKPYLCQHPGCQKAFSNSSDRAKH
QRTHLDTXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXPIFSSNHSSRSGTAAGPMPPPHPVSHP
SPGHNVQGSPHXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXT
QQSPGAHLKSYQPETSSSFQPNGIHVQGFYGQLQTFCPPHYTENQRTAPPSSCSVIPSFE
DCLGPTTMGQAGFDVFHRAFSTHSGITVYDLPSSSSSLFGESLRSGPEDTTFLQISAVDR
CPSQLSSVYTEG
Download sequence
Identical sequences ENSDORP00000012597 ENSDORP00000012597

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]