SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSDORP00000012607 from Dipodomys ordii 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSDORP00000012607
Domain Number 1 Region: 37-229
Classification Level Classification E-value
Superfamily p53-like transcription factors 3.42e-72
Family Rel/Dorsal transcription factors, DNA-binding domain 0.0000000122
Further Details:      
 
Domain Number 2 Region: 482-699
Classification Level Classification E-value
Superfamily Ankyrin repeat 1.47e-56
Family Ankyrin repeat 0.00000855
Further Details:      
 
Domain Number 3 Region: 225-357
Classification Level Classification E-value
Superfamily E set domains 4.67e-45
Family NF-kappa-B/REL/DORSAL transcription factors, C-terminal domain 0.00000193
Further Details:      
 
Domain Number 4 Region: 764-843
Classification Level Classification E-value
Superfamily DEATH domain 0.0000000000416
Family DEATH domain, DD 0.0042
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSDORP00000012607   Gene: ENSDORG00000013409   Transcript: ENSDORT00000013408
Sequence length 897
Comment pep:novel genescaffold:dipOrd1:GeneScaffold_1551:67251:73168:1 gene:ENSDORG00000013409 transcript:ENSDORT00000013408 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MDSCYNPALGGIPEYDFKFSPSIVEAKDPAPEAADVPYLVIVEQPKQRGFRFRYGCEGPS
HGGLPGASSEKGRKTYPTVKICNYEGLAKIEVDLVTHSDPPRAHAHSLVGKQCSDLGVCA
VSVGPKDMTAQFNNLGVLHVTKKNMMEIMIQKLQRQRLRSRPQGLTEAERRELEQEAKEL
KKVMDLSIVRLRFSAFLRASDGSFSLPLKPVISQPIHDSKSPGASNLKISRMDKTAGSVR
GGDEVYLLCDKVQKDDIEVRFYEDDENGWQAFGDFSPTDVHKQYAIVFRTPPYHKMKIDR
PVTVFLQLKRKRGGDVSDSKQFTYYPLVEDKEEVQRKRRKVLPTFSQPFGGGSHMGGGSG
GSAGGYGGAGGGGSLGFFPSSLAYSPYQSGAAPMGCYPGGGGGAQMAVGAPSGDAGEEAA
EPGTPQGEPEAPDALQQAREYNARLFGLTQRSARALLDYGITADARALLAGQRHLLAAQD
ENGDTPLHLAIIHGQTNVFEQIVHVIYHAQHLGMVNITNHLHQTPLHLAVITGQTKVVSF
LLQVGADPALLDRHGDSAVHLALRAGAGAPDLLRALLCSGAPTVPKMLHMPDFEGLYPIH
LAVRARSPECLDLLVDNGAEVEAAERQGGRTALHLATEMEELGLVTYLVTKLHANVNART
FAGNTPLHLAAGLGSPTLTRLLLKAGADIHAENEEPLCPIPSPPTSGSDSDSEGPESDTQ
NSFRGHTPLDLTHSTKVKTLLLNAAQNTMEPPLAPPSPKESELSLGDATLQNLEQLLDGP
EAQGSWAELAERLGLRSVVDTYRKTASPSGSLLRSYKLAGGDLAGLLDALSDMGLDEGVK
LLTGPESQDKLPSTTAEVKEDSAYESQSVKEDEAEKLGPPPEPPGGLSHGHPQPQVH
Download sequence
Identical sequences A0A1S3FBD7
ENSDORP00000012607 ENSDORP00000012607 XP_012873242.1.60039 XP_012873243.1.60039

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]