SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSDORP00000012620 from Dipodomys ordii 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSDORP00000012620
Domain Number 1 Region: 49-84
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.000000536
Family HkH motif-containing C2H2 finger 0.038
Further Details:      
 
Weak hits

Sequence:  ENSDORP00000012620
Domain Number - Region: 263-329
Classification Level Classification E-value
Superfamily occludin/ELL-like 0.0929
Family Occludin/ELL domain 0.021
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSDORP00000012620   Gene: ENSDORG00000013421   Transcript: ENSDORT00000013421
Sequence length 368
Comment pep:novel genescaffold:dipOrd1:GeneScaffold_2743:55128:56234:1 gene:ENSDORG00000013421 transcript:ENSDORT00000013421 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MASSASSRAPAGKRVVNQEELRRLMKEKQRQSTNRKKIDSPFAKYNRLGQLSCALCNTPV
KSELLWQTHVLGKQHRERVAELKGAKGAVPAPSESTAPPSVSKRKAPDAESQEAKRVKAA
APAPQVLPSASALPPGKESPRAATSSKPSGLGLLPAYEDEEDDDDEECEGEGREEDGSKQ
ASDTQGKEPSLPSSREASSVLPSGSFNTNLPTAPLIPHSGSIEKAEIHEKVVERRENTAE
ALPEGFFDDPEVDAKVRKVDAPKDQMDKEWDEFQKAMRQVNTISEAIVAEEDEEGRLDRQ
IGEIDEQIECYRRVENLRNRQDEIKNKLKEVLTIKELQKKEEENTDSDDEGELQDLLSQD
WRVKGALL
Download sequence
Identical sequences A0A1S3GWK3
XP_012892362.1.60039 ENSDORP00000012620 ENSDORP00000012620

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]