SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSDORP00000012621 from Dipodomys ordii 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSDORP00000012621
Domain Number 1 Region: 474-679
Classification Level Classification E-value
Superfamily DNA ligase/mRNA capping enzyme, catalytic domain 1.89e-48
Family ATP-dependent DNA ligase catalytic domain 0.00027
Further Details:      
 
Domain Number 2 Region: 689-829
Classification Level Classification E-value
Superfamily Nucleic acid-binding proteins 9.42e-34
Family DNA ligase/mRNA capping enzyme postcatalytic domain 0.00028
Further Details:      
 
Domain Number 3 Region: 90-202
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 3.71e-31
Family PARP-type zinc finger 0.00000108
Further Details:      
 
Domain Number 4 Region: 928-1009
Classification Level Classification E-value
Superfamily BRCT domain 6.83e-16
Family DNA ligase 0.0000362
Further Details:      
 
Domain Number 5 Region: 253-496
Classification Level Classification E-value
Superfamily ATP-dependent DNA ligase DNA-binding domain 0.0000000275
Family ATP-dependent DNA ligase DNA-binding domain 0.018
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSDORP00000012621   Gene: ENSDORG00000013422   Transcript: ENSDORT00000013422
Sequence length 1011
Comment pep:novel genescaffold:dipOrd1:GeneScaffold_2743:71190:93736:1 gene:ENSDORG00000013422 transcript:ENSDORT00000013422 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MTLAFKIFFPQNLRALGRKELCLLRKQYHWPEIRQFSQWSETAVLRGHSLFQRRKPVQSF
QGGHLRPLATHLVFLPGSHVGLCSGPCEMAEQRFCVDYAKRGTAGCKKCKEKIVKGVCRI
GKVVPNPFSESGGDMKEWYHIKCMFEKLERARATTKKIEDLTELEGWEELEDNEKEQITQ
HIADLSSKATGTPKKKAVVQAKLTSTGQVASPVKGAAVTTSTNPRKFSGFSAKPNNSEQD
PSNPTTKTSLSSSRCDPKHKDCLLREFRKLCAMVADNPSYNTKTQIIQDFLRKGSAGDGF
HGDVYLTVKLLLPGVIKSVYNLNDKQIVKLFSRIFNCNPDDMARDLEQGDVSETIRVFFE
QSKSFPPASKSLLTIQEVDEFLLLLSRLTKEDEQQQALQDIASRCTGNDLKCIIRLIKHD
LKMNSGAKHVLDALDPNAYEAFKASRNLQDVVERVLLNEQEVEKEPGQRRALSVQASLMT
PVQPMLAEACKSIEYAMKKCPNGMFSEIKYDGERVQVHKDGDHFSYFSRSLKPVLPHKVA
HFKDYIPLAFPGGHSMILDSEVLLIDNQTGKPLPFGTLGVHKKAAFQDANVCLFVFDCIY
FNDVSLMDRPLCERRKFLHDNMVEIPNRIMFSEMKRVTKASDLADMINRVIREGLEGLVL
KDVKGTYEPGKRHWLKVKKDYLNEGAMADTADLVVLGAFYGQGSKGGMMSIFLMGCYDPS
SQKWCTVTKCAGGHDDATLARLQKELDMVKISKDPSKIPSWLKINKIYYPDFIVPDPKKA
VWEIGAEFSKPAHTADGISIRFPRCTRIRDDKDWKSATNLPQLKELYQLSKERADFTVVA
GDEGSSTTGGSSGENEGTSGSAASRTTPKGSPKKPSTSARKAEGKLNNPSSKNGNRPATK
PSPVKLGANPSLKFSPVKVGEKRKATDETPCQTKVLLDIFTGVRLYLPPSTPDFSRLRRY
FVAFDGDLVQEFDIASATHVLGSGDKNCKAHVVSPEWIWACIRKRRLVAPC
Download sequence
Identical sequences ENSDORP00000012621 ENSDORP00000012621

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]