SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSDORP00000012686 from Dipodomys ordii 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSDORP00000012686
Domain Number 1 Region: 151-242
Classification Level Classification E-value
Superfamily C-type lectin-like 6.65e-18
Family C-type lectin domain 0.0026
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSDORP00000012686   Gene: ENSDORG00000013492   Transcript: ENSDORT00000013490
Sequence length 242
Comment pep:novel genescaffold:dipOrd1:GeneScaffold_2115:3250:12785:1 gene:ENSDORG00000013492 transcript:ENSDORT00000013490 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSRVLALAGWLIGLAFLSLLPSGCPQPTADDPCSVQILVPGLKXXXXXXXXXXXXXXXXX
XXXXXXXXDVGDKGQKGSVGRHGKYGPIGAKXXXXXXXXXXXXXXXXXXXLPCECGQLRK
AIGEMDNHVTQLATELKFIKNAVAGVRETESKIYLLVKEEKRYAEAQLSCQGRGGTLGMP
KDEASNGLMAAYLAQAGLARVFIGINDLEKEGAFVYADRSPMQTFNKWRRGEPNNAFDEE
DC
Download sequence
Identical sequences ENSDORP00000012686 ENSDORP00000012686

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]