SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSDORP00000012710 from Dipodomys ordii 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSDORP00000012710
Domain Number 1 Region: 25-290
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 4.86e-68
Family Protein kinases, catalytic subunit 0.00011
Further Details:      
 
Domain Number 2 Region: 356-551
Classification Level Classification E-value
Superfamily Ankyrin repeat 1.47e-55
Family Ankyrin repeat 0.0001
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSDORP00000012710   Gene: ENSDORG00000013515   Transcript: ENSDORT00000013515
Sequence length 553
Comment pep:novel genescaffold:dipOrd1:GeneScaffold_3885:49442:58538:1 gene:ENSDORG00000013515 transcript:ENSDORT00000013515 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAANAMEQRLGSLLVFTRDDFEDDWHRVASGGFGQVFQARHKRWRTQYAIKCSPCVQHDA
SSSDVNCLIEEAAKMEKVKFQHIVSIYGVCRQPLGIVMEFMANGSLEKMLPAHRLGWQLK
FRIIHETSLAMNFLHSIKPPLLHLDLKPGNILLDNNMHVKISDFGLSKWMEQSTRMQYIE
RSALRGTLSYIPPEMILDSNQAPGPKYDVYSFGIVIWELLTQKKPYEGLSMMAIIIRVGT
GMRPTVQPVSDEWPGEAQQMADLMRRCWDQDPKKRPCFQDITIETDMLLSLLPSPVAELE
SEALARKVSCKPSLHRARQVSGEVSPELTDTDSGDYLRQVLQCSDSESLVPSDEELHVYE
NKVTPLHFLVAQGSVEQVKLLLAHEVDVDCQTASGYTPLLIAAQDQQPDLCALLLAHGAD
ANLADEDGWAPLHFAAQNGDDRTARLLLDHGALVDAQEHEGWTPLHLAVQNNFENVARLL
VSRQADPNKQEAEGKTPLHVAAYFGHVSLVKLLTGQGAELDVGQDLRTPLHLAVERGKVR
AIQFLLKSGATLD
Download sequence
Identical sequences ENSDORP00000012710 ENSDORP00000012710

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]