SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSDORP00000012723 from Dipodomys ordii 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSDORP00000012723
Domain Number 1 Region: 1953-2188
Classification Level Classification E-value
Superfamily DBL homology domain (DH-domain) 5.5e-56
Family DBL homology domain (DH-domain) 0.0000374
Further Details:      
 
Domain Number 2 Region: 2188-2312
Classification Level Classification E-value
Superfamily PH domain-like 1.88e-30
Family Pleckstrin-homology domain (PH domain) 0.0033
Further Details:      
 
Domain Number 3 Region: 1760-1823
Classification Level Classification E-value
Superfamily Cysteine-rich domain 0.0000000000628
Family Protein kinase cysteine-rich domain (cys2, phorbol-binding domain) 0.019
Further Details:      
 
Weak hits

Sequence:  ENSDORP00000012723
Domain Number - Region: 153-225
Classification Level Classification E-value
Superfamily Ankyrin repeat 0.000358
Family Ankyrin repeat 0.0071
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSDORP00000012723   Gene: ENSDORG00000013525   Transcript: ENSDORT00000013528
Sequence length 2782
Comment pep:novel genescaffold:dipOrd1:GeneScaffold_5277:58464:193998:1 gene:ENSDORG00000013525 transcript:ENSDORT00000013528 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MKLTPQQAPLYGDCVVTVLLAEEDKVEDDVVFYLVFSGSTLHHYTSTRKVSSDTLETIAP
GHDCCETVKVLLCASKEGLPVFVVAEEDFHFVQDEACDAARFLAASAGDQQALNFTRFLD
RSGPPSGDVNSLDEKVALAFRHLKLPAEWNVLGTDHMLHDGTPRETLMHFAVRLGLLRLT
WFLLQKPGGRGALSIHNQEGATPVSLALERGYHQLHQLLTEENAGEPDSWSSLSYEIPYG
DCSVRHHRELDIYTLTSESESHEPTFPGDSCTGHIFKLMNIQQQLMKTSIKQMDNLTPLV
TAQDPSCLPSAPETASQFLPCASESSDSRQISSLPEETESTPCCQGSLAEQIKSPRDLST
EAEEENSDCSHRKKNKGVEKTRGKVEPVPLVDSGTVSDQDSHLQRLPDCGGKDTEDLLSC
RPRHEETGTQLSGVATGQESVSNSVQPGDTVTELGTSQHSSGGELADGSVTDASAPESTR
QAEPSLVNLAATTQNNMLQAGEGIEERFENSPVSTVRSELVDKDVTNCFSAASVLSANKS
AESPPALSSGETPDENTVGTETLRCCGELAEIVRDQNTVVIRAATEDKISSVSELDTPLA
GTCEVMSPCDLTCPVLQTDAMLHQKSEANSSHAQSQNSQSPVCCTTGDDKPCSDSACQQS
IVPSSGELVVQHCSDSARRPEITTTGQPSTQDLCTSTGLEDSQADPVPSDPVRVTQECGN
FCPLEVLGRKVQGKDLKQDTSLMNSPEVASCLPLVVSQTEKELVPDQTVPSDSVFSLASS
PVGESVTKDDALSLVPSQKERGTATLELHRAVPCREGPDQGDSEEPDEQLLEDRAASPPS
SPAVGELQPSMGNTSPTGLGDEHEGPGHSATPEALTDPSLLSVETATLASESVLTEEEKN
PVVPESAAAQGQDDEDKAVTRSSIKEDTLSSETLQEEQRIPPLAQETARFGDQPVLAACT
EDAALQPHESLDTPSACLKTEATHNKEEAPQASPLTEGGAPLSLVPPGPGLAADSREEVS
GAEPSSSSPQPGLLPRESKAAHCDPPLPLDGEVTNTQVPGTTSTCEVGRNAMEDVVVVNT
LQSTAESRGKDLSRNTEDNSVSEVSVSREKNMIVSLPGALPDKGGIGFQGAAAPETVPFD
QKRGRQEGDHSCSMADSKEAHRDDGTLPPFAKEPPTDTGLLVLDDKTLGGMRQVTQASAP
GEERSNLSLPGMVSVVPKGADSIEEAASRLVEAVIERVKASGALVTGGEVCHISSLSSSE
LGPRTEQPENASVDKASAFPLGETLQIASTGEATSSLKGCFDRREEPEKITLLVKEPEPA
TEMPGTKAEDEVDFLSPTRASSVSEEATVGNGAAAPQMKPGPESPTINRESWCSIEPCPG
AASLLASKQSTECENFLAVGLGGECASKQAVLQRESESDTDLFHSPSDEMDSIIFSKPEE
EQLVCDIMGSSSSTDDTASLDRHSSHGSDGSLPPASKLNKPRDHQSPNGFYSPGMGMEGR
ESESEPTGSGDVEEEEMDSITEVPANCSILRSSMRSLSPFRRHSWGPGKNAASDAEMNQR
SMSWCPSGVQYSAAPSADFNYRSFSLEGLTGGDGVGNKPSSSLEVNSANSKDLRHPFGIE
ERRDSLVSLSEENLESNQREHRIFDQQTYHRSKQQRFNYCTSAISSPLTKSISLMTISHP
GLDNSRSFHNTSANLAESITEENYNFLPPSLTKKDFEGKSGTKVSRTFSYIKNKMSSSKK
SKEKEKEKDKIKEKEKDSKEKEKDKKPLNGHTFSSIPIVGPISCSQCMKPFTNKDAYTCA
NCSAFVHKGCRESLASCAKVKMKQPKGTLQAHDTSSLPTVIMRNKPSQPKERPRSAVLLA
GDASAAPVFANRRSQQSVSLSKSVSIQNITGVGNDENMSNTWKFLSHSTDSLNKICKVNE
STESLTDEGVGTDMNEGQLMGDFETDSKQLEAESWSQIVDSKFLKQQKKDIVKQQEVIYE
LMQTEFHHIRTLKIMSDVYSRGMMTELLFEQQMVDKLFPCLDELISIHSQFLQRILERKK
ESLVDKSEKNFLIKRIGDVLINQFSGENAERLKKVYGKFCGQHNQSVNYFKDLCTKDKRF
QAFVKKKMGSSLVRRLGIPECILLVTQRITKYPVLFQRILQCTKDNEVEREDLAQSLSLV
KDVIGAVDSKVASYEKKVRLSEIYTKTDSKSIMRMKSGQMFAKEDLKRKKLVRDGSVFLK
SVTGRLKEVQAVLLSDILVFLQEKDQKYIFASLDQKSTVISLKKLIVREVAHEEKGLFLI
SMGVKDPEMVEVHASSKEERNSWIQIIQDTINTLNRDEDEGIPSENEEEKKMLDTKAREL
KEQLQQKDQQILLLLEEKEMIFRDMSECSTPLPECPTHPRLSSTREAPKETKSAISEVEI
LQGLVSGSLGGTLGQAASSPAEQEATVGPISLPRRAETFGGFDSHQMNASKGGEKEDDDG
QDLRRAESDSGLKKGGNANLVFMLKRNSEQVVQSIVHLHELLSTLQGVVLQQDSYIEDQR
LVLSERVLTRSLSRPSSLIEQEKQRSLEKQRQDLANLQRQQAQHLEEKRRREREWEARER
ELREREARLAEREEKVQLGQQNLERDREELRHKKGTYQSDLERLRAAQRQLEREQEQLRR
REAELLSQRQLEPDLCQVPHPHSKLMRIPSFFPNPEEHPLPSAPLATKSGSLDSDLSISP
KRNSLSRTHKDKGPFHILSSPGQPSKGPEGQAQAPSSATTRLFGLTKPKEKKEKKKKSKG
SRSQPGDGPASEVSAEGEEIFC
Download sequence
Identical sequences ENSDORP00000012723 ENSDORP00000012723

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]