SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSDORP00000012756 from Dipodomys ordii 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSDORP00000012756
Domain Number 1 Region: 197-301
Classification Level Classification E-value
Superfamily HAD-like 7e-21
Family NLI interacting factor-like phosphatase 0.0049
Further Details:      
 
Domain Number 2 Region: 589-698
Classification Level Classification E-value
Superfamily BRCT domain 0.0000000000032
Family DNA-repair protein XRCC1 0.093
Further Details:      
 
Weak hits

Sequence:  ENSDORP00000012756
Domain Number - Region: 3-88
Classification Level Classification E-value
Superfamily Single hybrid motif 0.000514
Family Biotinyl/lipoyl-carrier proteins and domains 0.0058
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSDORP00000012756   Gene: ENSDORG00000013560   Transcript: ENSDORT00000013563
Sequence length 926
Comment pep:novel genescaffold:dipOrd1:GeneScaffold_379:16128:60486:1 gene:ENSDORG00000013560 transcript:ENSDORT00000013563 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
GPAPLRLLEWRVATGAAVRIGSVLAVCEAAAAAAQPPGPGPARAASGGCVRAARAERRLK
SERAGVVRELCAQPGQVVAPGALLVRLEGCSHPVVMKGLCAECGQDLTQLQSKNGKQQMP
LSTATVSMVHSVPELMVSSEXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXGIFHFQLGRGEPMLHTRLRPHCRDFLEKIAKLYELHVFTFGSRLYAHTIAGFLDPEK
KLFSHRILSRDECIDPFSKTGNLKNLFPCGDSMVCIIDDREDVWKFAPNLITVKKYVYFP
GTGDVNAPPGSREPQARKKVSSKSADALEEAPPVKGSEGAEQAPGAEQSNGLGKPPRELS
GGESARDFSKAGERDPCPLTPAPAASSPGRQELADAPELPVSAEQTDRTSPGVQPAQGAS
GPDLDFDLSSDSDSSDSEGQKSSSSDGESEKRSQKKSSVTQDGVRVPQQGVSLKGGRPPA
QGLAETGPSAHLHDKGPDLDMQEEAERDGLCGLGNGCVDRKEAETESQNSEQSGVTAGES
LDQSMGEEEEEDTDEDDHLVHLEEILVRVHTDYYTKYDRYLRRELEEAPDIRKIVPELTG
KVLADVAVIFSGMHPTDFPIEKTREHYHATSLGARVLTQLVLSPDAPDRATHLIXXXXXT
EKVRQAQECQHLHVVNPDWLWSCLERWDKVEEQLFPLTDDDTRPHREKSPATFPDRQNML
PAALFHPTPVHPKVQPGPEVRIYDSHTGKLIRTGAQGRPPPSGLSVHGDPSSFRAIQPLQ
QQMFGEELPSAGDGEQPGPARRERQPSMSETMPLYTLCKEDLESMDKEXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXGHKRKLNEEDAASESS
NDDEEGSSSEADEMAAALEAELNDLM
Download sequence
Identical sequences ENSDORP00000012756 ENSDORP00000012756

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]