SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSDORP00000012758 from Dipodomys ordii 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSDORP00000012758
Domain Number 1 Region: 387-433,490-689
Classification Level Classification E-value
Superfamily DNA/RNA polymerases 2.15e-68
Family Lesion bypass DNA polymerase (Y-family), catalytic domain 0.00012
Further Details:      
 
Domain Number 2 Region: 46-125
Classification Level Classification E-value
Superfamily BRCT domain 3.27e-18
Family DNA topoisomerase II binding protein 1, TopBP1 0.052
Further Details:      
 
Domain Number 3 Region: 694-808
Classification Level Classification E-value
Superfamily Lesion bypass DNA polymerase (Y-family), little finger domain 0.00000000000000294
Family Lesion bypass DNA polymerase (Y-family), little finger domain 0.0053
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSDORP00000012758   Gene: ENSDORG00000013563   Transcript: ENSDORT00000013565
Sequence length 1235
Comment pep:novel genescaffold:dipOrd1:GeneScaffold_1965:105784:162352:-1 gene:ENSDORG00000013563 transcript:ENSDORT00000013565 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MRRGGWRKRAENDGWEKWGGYMAAKVQKLDEQFRSDAAKQKDGTSSEIFSGVAIYVNGYT
DHSAEELRKLMMLHGGQYHVYYSRSKTTHIIATNLNAKIKELKGEKVIRPEWIVESIKAG
RLLSYLQLYQSHKSFTYSVCPEDPMSPIAKQLNNRVXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXLQSTRNTDVLRSPHRTNSLLPPLHSNTKINGAHH
STVQGPSSTKSTSLVPTYSKAAPSVPSKPSDCNFISDFYSHSRLHHISTWKCELTEFVNT
LQRQSSGIFPGREKLKKMKTCRSALVVTDTGDSSVLNSPRHQSCIMHVDMDCFFVSVGIR
NRPDLKGKPVAVTSNRGTGRAPXXXXXXXXXXXXXXXXXXXXXXXXDIPDLSMWENQDSA
QTNGIDSVLSKAEIASCSYEAXXXXXXXXXXXXHAKQLCPNLQAVPYDFHAYKEVAQTMY
ETLASYTHNIEAVSCDEALVDITEILAETRLTPDEFANAVRMEIKDKTKCAASVGIGSNI
LLARMATRKAKPDGQYHLQPDEVDDFIRGQLVINLPGVGRSMESKLTALGIRTCGDLQYM
TMAKLQKEFGPKTGQMLYRFCRGLDDRPVRTEKERKSISAEINYGIRFTQPKEAEAFLLS
LSEEIQRRLEAAGMKGKRLTLKIMVRKPGAPVETAKFGGHGICDNIARTVTLDQATDSAK
IIGKATLNMFHTMKLNISDMRGVGIQMNQLTPANPNTSTCSSRPSVQSSHFSGGSHTVRD
LFQAQKAKKTTEEQHKEVFMATVDLEIPPASRNCTFLPSFSTHLTTVSADNNKVESTRKW
NGLHSPISVQSRLNLSIEIPSPSQLDESVLEALPPDLREQIKQVCAIQGEPHGDKKKEPV
NGCNTGILPQPIGTVLLQMPQESISDTGINVIALPAFSQVDPEVFAALPAELQKELKAAY
DQRQRQGEATSHQHSTSTSVPKNPLLQLKPAAVKDKKKKKKKPISSPQKIQSPLKAKLLI
SPAKILPGAYGSPQKLIDGFLKHEGPAAEKPMEELSASTSGVPGLYSLQPDQSSCVRHVA
PNLAGAVEFNDVKTLLKEWITTISDPMEEDILQVVKYCTDLIEEKDLEKLDLVIKYMKRL
MQQSVESVWNMAFDFILDNVQVVLQQTYGSTLKVT
Download sequence
Identical sequences ENSDORP00000012758 ENSDORP00000012758

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]