SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSDORP00000012780 from Dipodomys ordii 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSDORP00000012780
Domain Number 1 Region: 265-322
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 4.68e-25
Family Classic zinc finger, C2H2 0.0042
Further Details:      
 
Domain Number 2 Region: 20-80
Classification Level Classification E-value
Superfamily KRAB domain (Kruppel-associated box) 9.29e-25
Family KRAB domain (Kruppel-associated box) 0.001
Further Details:      
 
Domain Number 3 Region: 321-378
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 4.24e-23
Family Classic zinc finger, C2H2 0.0054
Further Details:      
 
Domain Number 4 Region: 365-425
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 8.1e-20
Family Classic zinc finger, C2H2 0.0091
Further Details:      
 
Domain Number 5 Region: 458-495
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0000000000821
Family Classic zinc finger, C2H2 0.0072
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSDORP00000012780   Gene: ENSDORG00000013595   Transcript: ENSDORT00000013592
Sequence length 574
Comment pep:novel genescaffold:dipOrd1:GeneScaffold_771:31435:40329:1 gene:ENSDORG00000013595 transcript:ENSDORT00000013592 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MDLEDLAAAVTMAAPPPAARLQEPVTFRDVAVDFTQEEWGQLDLTQRTLYREVMLETFRH
LLSVGPELPKPEVISQLEQGAELWIERGVTQGYNPVWALGPEGYMFLKSQGLPKEEPFPY
TERKELLKETPRPPMMVGAQECEGQLQSLSQNPANLRQLELGLKDGSVQSQDYESHRQEN
CVLRSNVDPFLEISRREYFCTYDSQVKNSEHNSILVSQRPADLPGTQPCNNKECHRATEQ
TVPATELIRSPVLDKPYKCTDCGKSFNHNAHLTVHKRIHTGERPYMCKECGKAFSQNSSL
VQHQRIHTGDKPYKCAECGKSFCHSTHLTVHRRIHTGEKPYECQDCGRAFNQNSSLGRHK
RTHTGEKPYTCSVCGKSFSRTTCLFLHLRTHTEERPFECNHCGKGFRHSSSLAQHQRKHA
GEKPYECQQRLIFEQTPAFTKHEWTETLGCAPPLSQDEKTQRSDKPFKCNQCGKCFIQSS
HLIRHQVTHSRDEPHGRTRRRERSCGQKAQLTHHQQSNSAEDPGSQAKAGQPASKTQALF
DIHEIMQQKNPVHVIGVEEHPLGTSKIVDFKEST
Download sequence
Identical sequences ENSDORP00000012780 ENSDORP00000012780

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]