SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSDORP00000012790 from Dipodomys ordii 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSDORP00000012790
Domain Number 1 Region: 2-204
Classification Level Classification E-value
Superfamily Ankyrin repeat 7.28e-60
Family Ankyrin repeat 0.00014
Further Details:      
 
Domain Number 2 Region: 276-475,504-541
Classification Level Classification E-value
Superfamily Ankyrin repeat 2.49e-56
Family Ankyrin repeat 0.00014
Further Details:      
 
Domain Number 3 Region: 662-966
Classification Level Classification E-value
Superfamily Ankyrin repeat 4.46e-55
Family Ankyrin repeat 0.0000282
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSDORP00000012790   Gene: ENSDORG00000013602   Transcript: ENSDORT00000013602
Sequence length 967
Comment pep:novel genescaffold:dipOrd1:GeneScaffold_432:32255:164050:-1 gene:ENSDORG00000013602 transcript:ENSDORT00000013602 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MLIHKTEDVNALDSEKRTPLHVAAFLGDAEIIELLILSGARVNAKDNMWLTPLHRAVASR
SEEAVQVLIKHSADVNARDKNWQTPLHVAAANKAVKCAEVIIPLLSSVNVSDRGGRTALH
HAALNGHIEMVNLLLAKGANINAFDKKDRRALHWAAYMGHLDVALINHGAEVTCKDKKGY
TPLHAAASNGQLNIVKHLLNLGVEXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXSKDGKSPLHMTAVHGRFTRSQTLIQ
NGGEIDCVDKDGNTPLHVAARYGHELLINTLITSGADTAKCGIHSMFPLHLAALNAHSDC
CRKLLSSGQKYSIVSLFSNEHVLSAGFEIDTPDKFGRTCLHAAAAGGNVECIKLLQSSGA
DFRKKDKCGRTPLHYAAANCHFHCIETLVTTGANVNETDDWGRTALHYAAASDIDRSKTI
LGNGHENSEELERSREMKEKEAALCLEFLLQNDANPSIQDKEGYNSIHYAAAYGHRQCLE
LXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXTPLMLAVAYGHIDAVSLLLEKEANVDAVDIMGCTALHRGIMTGHEECVQMLLEQEVSI
LCKDSRGRTPLHYAAARGHATWLSELLQMALSEEDCCFKDNQGYTPLHWACYNGNENCLE
VLLEQKCFKFMGNPFTPLHCAIINDHENCASLLLGAIDSNIVSCRDDKGRTPLHAAAFGD
HVECLQLLLRHNAQVNAVDNSGKTALMMAAENGQAGAVDILVNSAQADLTIKDKDLNTPL
HLASSKGHEKCALLILDKIQDESLINAKNNALQTXXXXXXXXSGLKVVVEELLAKGACVL
AIDENGK
Download sequence
Identical sequences ENSDORP00000012790 ENSDORP00000012790

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]