SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSDORP00000012800 from Dipodomys ordii 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSDORP00000012800
Domain Number 1 Region: 534-591
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.33e-23
Family Classic zinc finger, C2H2 0.0031
Further Details:      
 
Domain Number 2 Region: 59-117
Classification Level Classification E-value
Superfamily KRAB domain (Kruppel-associated box) 4.45e-21
Family KRAB domain (Kruppel-associated box) 0.0012
Further Details:      
 
Domain Number 3 Region: 394-449
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.57e-20
Family Classic zinc finger, C2H2 0.0046
Further Details:      
 
Domain Number 4 Region: 338-395
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 4e-20
Family Classic zinc finger, C2H2 0.011
Further Details:      
 
Domain Number 5 Region: 282-339
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 2.76e-19
Family Classic zinc finger, C2H2 0.008
Further Details:      
 
Domain Number 6 Region: 478-535
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 3.59e-19
Family Classic zinc finger, C2H2 0.0068
Further Details:      
 
Domain Number 7 Region: 576-628
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 5.71e-17
Family Classic zinc finger, C2H2 0.016
Further Details:      
 
Domain Number 8 Region: 227-283
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.000000000000012
Family Classic zinc finger, C2H2 0.01
Further Details:      
 
Domain Number 9 Region: 438-472
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.000000155
Family Classic zinc finger, C2H2 0.012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSDORP00000012800   Gene: ENSDORG00000013613   Transcript: ENSDORT00000013613
Sequence length 664
Comment pep:novel scaffold:dipOrd1:scaffold_11747:15384:22741:-1 gene:ENSDORG00000013613 transcript:ENSDORT00000013613 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MQQVMLSEETPRLSSKLLWIATNTQLLEDKALQIPPYPALTKDRSQGKLPGADMLNQDQE
SMTFEDVAVNFTNKEWQSLTYSQKDLYKDVMLEIYDNIIFLGLLFPKPPLISHLEQRPKP
CNQHPQDEECPSCTSPVSTDKPWPEKEKTSLEQEIFENQEVCCVKHDKNLLNIIAEDLAA
RGVCIQDDQLENRGDVPRREKLRKEREGSGELTFKKPKNKTVLRHNFNPNSKCILYDNIH
TAQKCHECTHCGKKFIWHSELILHERTHSGEKPHVCTECGKAFKTRKQCSMHQVIHTGEK
PFGCTQCEKAFNSRSALGRHKKTHSGEKPHECQDCGKAFKTRNHLSIHHMIHTGKKPYIC
NDCRKSFQFKHALTIHSRIHTGEKPYECEKCGKAFSGSSVLTKHSRIHTGERPYECNQCG
KAFCRSSDLSKHKRIHSQEKHFGCPQCGKSLRMKAELSRHSKIHSKEKPYKCEQCGKAFR
HNSKRKAHEREHTGGKPYPCGDCGKTFQDRHCLAIHQRIHTGEKPYKCLECSKAFSWKSN
LTHHRRIHTGEKPYKCEVCGKAFHHSSVLRQHQRIHTGEKPCTCDACGAAFRQCSALIGH
KRVHTREEPYKCKECGKAFRVSSSLSVHKKRKHGVQRTHELDQSRKSPVIISPASGISVF
TTHT
Download sequence
Identical sequences ENSDORP00000012800 ENSDORP00000012800

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]