SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSDORP00000012812 from Dipodomys ordii 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSDORP00000012812
Domain Number 1 Region: 130-335
Classification Level Classification E-value
Superfamily NHL repeat 0.0000000000000497
Family NHL repeat 0.0091
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSDORP00000012812   Gene: ENSDORG00000013629   Transcript: ENSDORT00000013627
Sequence length 346
Comment pep:novel genescaffold:dipOrd1:GeneScaffold_6249:4207:14005:1 gene:ENSDORG00000013629 transcript:ENSDORT00000013627 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MARCWVCAAGVALFFASLVLHSHFCGPAXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXSYGHTVKKYNSFGDLVQVLGTPGKKGTALNPLQFDNPAELYVEDTEDIYIV
DGDGGLNNRLIKLSQNFMILWLRGNGTGPAKFNIPXXXXXXXXXXVWVADRGNKRLQVFD
KDTGEWLGAWSSCFTEEGPSSVRFTPDGKYLIVAQLNLSRLSILAAPPTGNLGHCSVIST
IQLPDQVLPHLLEIDRKTGAVYVAEIGAKQVQKFVPLNSHIPGFSV
Download sequence
Identical sequences ENSDORP00000012812 ENSDORP00000012812

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]