SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSDORP00000012818 from Dipodomys ordii 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSDORP00000012818
Domain Number 1 Region: 129-274
Classification Level Classification E-value
Superfamily C-type lectin-like 7.87e-26
Family C-type lectin domain 0.00023
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSDORP00000012818   Gene: ENSDORG00000013633   Transcript: ENSDORT00000013633
Sequence length 275
Comment pep:novel scaffold:dipOrd1:scaffold_6954:22401:23877:-1 gene:ENSDORG00000013633 transcript:ENSDORT00000013633 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
HLQEDLGLPDRRREENPASTAEGQGTEVTEEDQGDEEEEEATQAPPTPSSSPSPTPEDTI
TYILGRLAGLDAGLHQLHVRLHALDTRVVELTQGLRQLRETTGNTRDTVETLQEAQARAE
REHGRLEGCLKGLRLGHKCFFLSRDFETQPAAQARCAARGGSLAQPADRQQMDALARYLR
AALAPYNWPVWLGVHDRRAEGLYLFENGQRVSFFAWHRAPSPEPGARPSAAPHPLSPDQP
NGGVLENCVAQASDDGSWWDHDCDRRLYFVCEFPF
Download sequence
Identical sequences ENSDORP00000012818 ENSDORP00000012818

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]