SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSDORP00000012897 from Dipodomys ordii 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSDORP00000012897
Domain Number 1 Region: 138-194
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00000000000000105
Family Classic zinc finger, C2H2 0.0082
Further Details:      
 
Domain Number 2 Region: 100-151
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0000000000174
Family Classic zinc finger, C2H2 0.0098
Further Details:      
 
Domain Number 3 Region: 913-964
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00000000011
Family Classic zinc finger, C2H2 0.018
Further Details:      
 
Domain Number 4 Region: 617-669
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0000000728
Family Classic zinc finger, C2H2 0.014
Further Details:      
 
Domain Number 5 Region: 790-815,864-889
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.000000456
Family Classic zinc finger, C2H2 0.041
Further Details:      
 
Domain Number 6 Region: 265-315
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.000000477
Family Classic zinc finger, C2H2 0.032
Further Details:      
 
Domain Number 7 Region: 764-802
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00000369
Family Classic zinc finger, C2H2 0.02
Further Details:      
 
Domain Number 8 Region: 676-724
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00000877
Family Classic zinc finger, C2H2 0.028
Further Details:      
 
Domain Number 9 Region: 1207-1257
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0000182
Family Classic zinc finger, C2H2 0.049
Further Details:      
 
Weak hits

Sequence:  ENSDORP00000012897
Domain Number - Region: 459-516
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.000116
Family Classic zinc finger, C2H2 0.045
Further Details:      
 
Domain Number - Region: 705-758
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.000688
Family Classic zinc finger, C2H2 0.026
Further Details:      
 
Domain Number - Region: 1118-1142
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00525
Family Classic zinc finger, C2H2 0.046
Further Details:      
 
Domain Number - Region: 388-440
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0369
Family Classic zinc finger, C2H2 0.037
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSDORP00000012897   Gene: ENSDORG00000013718   Transcript: ENSDORT00000013718
Sequence length 1285
Comment pep:novel genescaffold:dipOrd1:GeneScaffold_6531:64376:208407:-1 gene:ENSDORG00000013718 transcript:ENSDORT00000013718 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
PNCKLEDKTEDGEAVDCKKRPEDGEELEDETVHSCDSCLQVFESLSEITHINQCQLAGVD
VEDDPTCSWPASSPSSKDQTSPSHGEGCDFGEEEGGPGLPYPCQFCDKSFSRLSYLKHHE
QSHSDKLPFKCTYCSRLFKHKRSRDRHIKLHTGDKKYHCSECDAAFSRSDHLKIHLKTHT
SNKPYKCAICRRGFLSSSSLHGHMQVHERNKDGSQSGSRMEDWKMKDTQKCSQCEEGFDF
PEDLQKHIAECHPECSPNEDRAALQCVYCHELFMEETSLLNHMEQVHSGEKKNSCSICSE
SFHTVEELYSHMDSHQQPESCNHSNSPSLVTVGYTSVSSTTPDSNLSVDSSTMVEAAPPI
PKSRGRKRAAQQAADMTGPSSKQAKVTYSCIYCNKQLFSSLAVLQIHLKTMHLDKPEQAH
ICQYCLEVLPSLYNLNEHVKQVHEAQDPGLIVSAMPAIVYQCNFCSEVVNDLNTLQEHIR
CSHGFANPAAKDSNAFFCPHCYMGFLTDSSLEEHIRQVHCDLSGSRFGSPVLGTPKEPVV
EVYSCSYCTNSPIFNSVLKLNKHIKENHKNIPLALNYIHNGKKSRALSPLSPVAIEQTSL
KMMQAVGGTPARPAGEYICNQCGAKYASLDSFQTHLKTHLDTVLPKLTCPQCNKEFPNQE
SLLKHVTIHFMITSTYYICESCDKQFTSVDDLQKHLLDMHTFVFFRCTLCQEVFDSKVSI
QLHLAVKHSNEKKVYRCTSCNWDFRNETDLQLHVKHNHLENQGKVHKCIFCGESFGTEVE
LQCHITTHSKKYNCKFCSKAFHAIILLEKHLREKHCVFETKTPNCGTNGASEQVQKEEVE
LQTLLTNSQESHNSHDGSEEDVDSSEPMYGCDICGAAYTMETLLQNHQLRDHNIRPGESA
IVKKKAELIKGNYKCNVCSRTFFSENGLREHMQTHLGPVKHYMCPICGERFPSLLTLTEH
KVTHSKSLDTGNCRICKMPLQSEEEFLEHCQMHPDLRNSLTGFRCVVCMQTVTSTLELKI
HGTFHMQKTGNGSAVQTTGRGQHVQKLYKCASCLKEFRSKQDLVKLDINGLPYGLCAGCV
NLSKSSSPGISLPPSTNRPGLGQNENLSAMEGKSKAGGLKTRCSSCNVKFESESELQNHI
QTVHRELVPDSNSTQLKTPQVSPMPRISPSQSDEXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXEGLNHECKLCSQTFDSPAKLQCHLIEHSFEGMGGTFKCPVCFTVFVQANKLQQHIFS
AHGQEDKIYDCTQCPQKFFFQTELQ
Download sequence
Identical sequences ENSDORP00000012897 ENSDORP00000012897

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]