SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSDORP00000012903 from Dipodomys ordii 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSDORP00000012903
Domain Number 1 Region: 2-139
Classification Level Classification E-value
Superfamily Ankyrin repeat 2.64e-33
Family Ankyrin repeat 0.00035
Further Details:      
 
Weak hits

Sequence:  ENSDORP00000012903
Domain Number - Region: 198-220
Classification Level Classification E-value
Superfamily Ankyrin repeat 0.0146
Family Ankyrin repeat 0.0084
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSDORP00000012903   Gene: ENSDORG00000013726   Transcript: ENSDORT00000013725
Sequence length 305
Comment pep:novel genescaffold:dipOrd1:GeneScaffold_3126:5299:28332:1 gene:ENSDORG00000013726 transcript:ENSDORT00000013725 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
ALIINGANLAARDDRGCTPVHLAATHGHSFTLQIMLRSGVDPSVTDKREWRPVHYAAFHG
RLGCLQLLVKWGCGIEEVDCNGNLPVHLAAMEGHLHCFKFLVSRMSSEKQALKAFNDNGE
NVLDLAQRFFKQNIVQFIQGTENEGNNAEDQEXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXAGQGHIECLQWLIKMGADSNITNKAERPSDVAXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXLSKSCRGSWSMND
SVEKS
Download sequence
Identical sequences ENSDORP00000012903 ENSDORP00000012903

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]