SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSDORP00000012932 from Dipodomys ordii 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSDORP00000012932
Domain Number 1 Region: 114-164
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00000000000298
Family HkH motif-containing C2H2 finger 0.014
Further Details:      
 
Domain Number 2 Region: 62-108
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0000000000289
Family HkH motif-containing C2H2 finger 0.0019
Further Details:      
 
Domain Number 3 Region: 2-52
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0000000000575
Family HkH motif-containing C2H2 finger 0.0009
Further Details:      
 
Domain Number 4 Region: 179-207
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.000000331
Family HkH motif-containing C2H2 finger 0.077
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSDORP00000012932   Gene: ENSDORG00000013755   Transcript: ENSDORT00000013754
Sequence length 236
Comment pep:novel genescaffold:dipOrd1:GeneScaffold_1884:10:11271:1 gene:ENSDORG00000013755 transcript:ENSDORT00000013754 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
EHMIQKNQCLFTNTQCKVCCAMLISESQKLAHYQSKKHANKVKRYLAIHGMETLKGETKR
LDSDQKSSRSKDKNQCCPICNMTFSSPVVAQSHYLGKTHAKNLKLKQQSTKVEALHQSRE
MIDPDKFCSLCHATFNDPAMAQQHYVGKKHRKQETKLKLMAHYGRLADPAVTDLTAGKGY
PCKTCKIVLNSIEQYQAHVSGFKHKNQSPKTAPLPLGQIPAQKQHISKDSQDTLEA
Download sequence
Identical sequences ENSDORP00000012932 ENSDORP00000012932

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]