SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSDORP00000012969 from Dipodomys ordii 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSDORP00000012969
Domain Number 1 Region: 35-152
Classification Level Classification E-value
Superfamily TPR-like 1.09e-19
Family Tetratricopeptide repeat (TPR) 0.0056
Further Details:      
 
Domain Number 2 Region: 847-885
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0000000198
Family Classic zinc finger, C2H2 0.054
Further Details:      
 
Domain Number 3 Region: 899-933
Classification Level Classification E-value
Superfamily CCCH zinc finger 0.0000235
Family CCCH zinc finger 0.0048
Further Details:      
 
Domain Number 4 Region: 498-527
Classification Level Classification E-value
Superfamily CCCH zinc finger 0.0000659
Family CCCH zinc finger 0.005
Further Details:      
 
Weak hits

Sequence:  ENSDORP00000012969
Domain Number - Region: 627-658
Classification Level Classification E-value
Superfamily CCCH zinc finger 0.00204
Family CCCH zinc finger 0.0065
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSDORP00000012969   Gene: ENSDORG00000013794   Transcript: ENSDORT00000013794
Sequence length 996
Comment pep:novel genescaffold:dipOrd1:GeneScaffold_1115:1997:31433:1 gene:ENSDORG00000013794 transcript:ENSDORT00000013794 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MERQKRKADIEKGLQFIQSTLPLKQEEYEAFLLKLVQNLFAEGNDLFREKDYKQALVQYM
EGLNVADYAASDQVSLPRELLCKLHVNRAACYFTMGMYEKSLEDSEKALGLDSENIRALF
RKARALNELGRHKEAYECSSRCSLALPHDESVTQLGQELAQKLGLRVRKAYKRPRELETF
SLLSNGTAAGVADQGMSNGFGSIDDIETGSTPNMTAVGTRSLRNCYVDLHSSPALLPSAP
AMSLFPHVLDLLAPLDSSGRAIPSTEGLDDFSDGDVFGPELDTLLDSLSLVQGGLPGSGV
PSELPQLIPVFPGGTPLLPPVVGGSIPVSSPLPPASFGLVIDPSKKLTASVLDTLDAPGP
ALDPLDLLPYSDTRLEALDTFGSVRGSLDKPDSFIXXXXXXXXXXXXXXXXXXXXPEPSM
PNTALLIKNPLAATHEFKQACQLCYPKTGPKAGDYTYREGLEHKCKRDILLGRLRSSEDQ
AWKRIRPRPTKTSFVGSYYLCKDMINKQDCKYGDNCTFAYHQEEIDVWTEERKGTLNRDL
LFDPLGGVKRGSLTIAKLLKEHQGIFTFLCEICFDSKPRIISKGTKDSPSVCSNLAAKHS
FYNNKCLVHIVRSTSLKYSKIRQFQEHFQFDVCRHEVRYGCLREDSCHFAHSFIELKVWL
LQQYSGMTHEDIVQESKKYWQQMEAHAGKASGSMGPRTHGPSTFDLQMKFVCGQCWRNGX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXLDMQQTYDMWLKKHNPGKPGEGTPISSREG
EKQIQMPTDYADIMMGYHCWLCGKNSNSKKQWQQHIQSEKHKEKVFTSDSDASGWAYRFP
MGEFRLCDRLQKGKACPDGDKCRCAHGQEELNEWLDRREVLKQKLAKARKDMLLCPRDDD
FGKYNFLLQEDGDTAGATPEASAAAPAAAATAPTGE
Download sequence
Identical sequences ENSDORP00000012969 ENSDORP00000012969

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]