SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSDORP00000012970 from Dipodomys ordii 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSDORP00000012970
Domain Number 1 Region: 106-268
Classification Level Classification E-value
Superfamily Metalloproteases ("zincins"), catalytic domain 1.07e-55
Family Matrix metalloproteases, catalytic domain 0.0000000678
Further Details:      
 
Domain Number 2 Region: 276-349
Classification Level Classification E-value
Superfamily Hemopexin-like domain 4.84e-23
Family Hemopexin-like domain 0.000011
Further Details:      
 
Domain Number 3 Region: 29-101
Classification Level Classification E-value
Superfamily PGBD-like 3.45e-19
Family MMP N-terminal domain 0.00056
Further Details:      
 
Domain Number 4 Region: 403-442
Classification Level Classification E-value
Superfamily Hemopexin-like domain 0.0000017
Family Hemopexin-like domain 0.00028
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSDORP00000012970   Gene: ENSDORG00000013795   Transcript: ENSDORT00000013795
Sequence length 448
Comment pep:novel genescaffold:dipOrd1:GeneScaffold_3145:6173:15493:-1 gene:ENSDORG00000013795 transcript:ENSDORT00000013795 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MHPGVLAAFFFLSWAHCRSLPLPSGDDDSDLSEEDLQFAEHYLKSYYHPRNLAGILKKSA
AGSMVERLREMQSFFGLEVTGQLDDNTLDVMKKPRCGVPDVGEYNVFPRTLKWSNMNLTY
RIVNYTPDMTHSEVEKSFKKAFKVWSDVTPLNFTRIHDGTADIMISFGTKEHGDFYPFDG
PSGLLAHAFPPGPNYGGDAHFDDDETTSTSKGYNLFLVAAHEFGHSLGLDHSKDPGALMF
PIYTYTGKNHFMLPEDDVQGIQSLYGPGDEDPNPKHPKTPDKCDPALSLDAITSLRGETM
IFKDRFFWRLHPQQVDAELFLTKSFWPELPNRVDAAYEHPSRDLIFIFRXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXYDDINHIMDKDYPRLIE
EEFPGIGDKVDAVYEKNLYLFFQWTHTV
Download sequence
Identical sequences ENSDORP00000012970 ENSDORP00000012970

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]