SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSDORP00000012982 from Dipodomys ordii 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSDORP00000012982
Domain Number 1 Region: 223-272
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.000000000031
Family Classic zinc finger, C2H2 0.01
Further Details:      
 
Domain Number 2 Region: 286-324
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00000956
Family Classic zinc finger, C2H2 0.02
Further Details:      
 
Weak hits

Sequence:  ENSDORP00000012982
Domain Number - Region: 96-121
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.000107
Family Classic zinc finger, C2H2 0.02
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSDORP00000012982   Gene: ENSDORG00000013805   Transcript: ENSDORT00000013808
Sequence length 365
Comment pep:novel genescaffold:dipOrd1:GeneScaffold_6320:1372:4626:-1 gene:ENSDORG00000013805 transcript:ENSDORT00000013808 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
TLGAAMRSALPGHCPENPPHARSAPLECALQLSQDISETEEQHGSSSERTSTDISLALDG
GDWERSLELELPREGKVGSFAESRSLPQFLGSEGPVCAECGKSVKQSSCLTGHLRMHTAE
PYLCACGGFKQSSLHTHCRTPTARPGSPLHRHTWSTHCECLECRKTSGQKSYASLEHESG
QSSKPVTHQRIHVGVTRCRCGSSPHTREQPGPCPKSKKDLPDHSAAHVRTSLGERPFSCH
DCHKMFCDHSRLVTHQHTGERPFEFEACGKEFVDGSALVEHQIHGRSFKCHACGQSFSRS
FRFTSHQHTHDRLCHCRVWGETFSRWPHFHTHGHSAGRPFHGSRYNGSFQQSAHLLCRQS
THAAW
Download sequence
Identical sequences ENSDORP00000012982 ENSDORP00000012982

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]