SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSDORP00000013007 from Dipodomys ordii 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSDORP00000013007
Domain Number 1 Region: 85-202
Classification Level Classification E-value
Superfamily POZ domain 4.5e-27
Family BTB/POZ domain 0.001
Further Details:      
 
Domain Number 2 Region: 560-612
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.000000000000011
Family Classic zinc finger, C2H2 0.0066
Further Details:      
 
Weak hits

Sequence:  ENSDORP00000013007
Domain Number - Region: 535-569
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.000206
Family Classic zinc finger, C2H2 0.0038
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSDORP00000013007   Gene: ENSDORG00000013837   Transcript: ENSDORT00000013835
Sequence length 687
Comment pep:novel genescaffold:dipOrd1:GeneScaffold_6602:124513:127173:-1 gene:ENSDORG00000013837 transcript:ENSDORT00000013835 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
QDGGGRGPGCSSGRRVRGGGVGPGARGPRPPRPPFSFLCSCGWGGGLILSFHNMEPSPLS
PSGAALPLPLSLAPPPLPLPAAAVVHVSFPEVTSALLESLNQQRLQGQLCDVSIRVQGRE
FRAHRAVLAASSPYFHDQVLLKGMTSISLPSVMDPGAFETVLASAYTGRLSMAAADIVNF
LTVGSVLQMWHIVDKCTELLREGRASATTTITTTAATSVTVPGVGVPSGSGGPVAPASMG
SVRSHTSSRASENQSPSSSNYFSPRESTDFSSSSQEAFAASAVGSGERRGGGPVFPAPVV
GSGAATSGKLLLEADELCDDGTDGRGAVVPGAGLRRPAYTPTSIVPQKHWVYVKRGGNCP
APAPLVPQDPELEEEEEEEDLVLTCEDDEDEELGGGSRVLSGGGPEATLSISDVRTLTEP
ADKGEEQVNFCESSNDFGHYESGGPGAGLDDSGGPTPSSYVPTHPPRPLLPLDMQGNQIL
VFPSSSSSSSQAPGQPPGNQAEHGAVTLGGASTAGLGMPGGNGGAAGGTAGSGDGNKIFL
CHCGKAFSHKSMRDRHVNMHLNLRPFDCPVCNKKFKMKHHLTEHMKTHTGLKPYECGVCA
KKFMWRDSFMRHRGHCERRHRMGGAGAVPGPGVSTGPTLQPKRESSGGGGASGDEASGAT
PPPNRRVWSPPSVHKVEMGFNGGGGAN
Download sequence
Identical sequences ENSDORP00000013007 ENSDORP00000013007

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]