SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSDORP00000013045 from Dipodomys ordii 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSDORP00000013045
Domain Number 1 Region: 666-715
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00000000209
Family Classic zinc finger, C2H2 0.023
Further Details:      
 
Domain Number 2 Region: 632-673
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00000192
Family Classic zinc finger, C2H2 0.015
Further Details:      
 
Weak hits

Sequence:  ENSDORP00000013045
Domain Number - Region: 751-783
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.000136
Family Classic zinc finger, C2H2 0.029
Further Details:      
 
Domain Number - Region: 121-159
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00423
Family Classic zinc finger, C2H2 0.039
Further Details:      
 
Domain Number - Region: 247-267
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0116
Family Classic zinc finger, C2H2 0.048
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSDORP00000013045   Gene: ENSDORG00000013877   Transcript: ENSDORT00000013876
Sequence length 949
Comment pep:novel genescaffold:dipOrd1:GeneScaffold_5132:8305:20278:1 gene:ENSDORG00000013877 transcript:ENSDORT00000013876 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MEESRSVAMLVPDVGEQEAILTAEGIISPSLEIDEPRKAKADPLIHVIQKLSRIVEHEKS
QKCLLIGKKRSRSNMTTHPLETQEVCEIPAKVTQLPAVRKAEVSQASFTPESLAHDDSKA
MSYQCSLCKFLSSSFSVLREHIKLHGQQNEVILMCSECHITSKSQEELEAHVVKEHENDI
SNHTPHKAQQCSTPSNSFCQRTTERTNETSGDIAVSMDSPQTHPGQTTSLAEMGRRKWYA
YEQYGMYRCLFCSYTCGQQRMLKTHAWKHAGEVDCSYPIFENENEPLGLLGSSTSAAPGG
VDAVVIAIGDSELSIHNGPAVQVQICSSEPLSSSSLDQHSEERVHLSRSVTLDPTEEEAL
EVMSDAEESLIADSLLSSAQKIISSSPNKKGHVNVIVERLPSAEELSQKPFLLNAELDEG
KTLNPSDGQAGCAGTGAIFRADKCTVDIGGLIIGWSNPEKKDSELLSKGLATDENAPPGR
RRTNSESLRLHSLAAEALVTMPIRAAELTRASLSHYGDINLLDPDTGQRQADRPLAAYSK
MMSPLKNTSEGLTSFSQSNSTLLALPEGGQELTDGQVKTGISMSLLTVIEKLRERTDQNA
SDDDILKELQDNAQCQPNSDTSLLGTNVVEYIPEAERPYRCRLCHYTSGNKGYIKQHLRV
HRQRQPYQCPICEHIANNSKDLESHMINHCKTRIYQCKQCEESFHYKSQLRNHEREQHSL
PETLSISSHEPRIASDAADGKYIQEGNKSSAQKQYRCDVCDYTSTTYVGVRNHRTIHNSD
KPYXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXVLGKYPEKSRW
TSEEKADLIAGSSENLLSTSELMSQASSESVDSNEGEKVSPTSNVSYSLEKTSSLAPPGM
EYCVLLFCCCICGFESTSKENLLDHMKEHEGEIVNIILNKDQHATISTD
Download sequence
Identical sequences ENSDORP00000013045 ENSDORP00000013045

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]