SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSDORP00000013056 from Dipodomys ordii 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSDORP00000013056
Domain Number 1 Region: 1090-1149
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.00000000000256
Family Complement control module/SCR domain 0.0021
Further Details:      
 
Domain Number 2 Region: 885-921
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000332
Family EGF-type module 0.0063
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSDORP00000013056   Gene: ENSDORG00000013891   Transcript: ENSDORT00000013891
Sequence length 1196
Comment pep:novel genescaffold:dipOrd1:GeneScaffold_2631:454:13757:1 gene:ENSDORG00000013891 transcript:ENSDORT00000013891 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MGASSVWTSGLLLLPLLLLLVAGDQXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXGDPDAPSSGDEGDIPSAEGPPAREPEPAAEAAAPESSGEEAPGAAPTRAPRPRG
PGPTGAAPTERRRGRFPGLNGRHFQQQEPRGPAAAQPRAPEGAGNRVEPPTEAEAGAPSP
RPWAVLTNEVEVPAAGPPAGKRPWPLSSTPSSIPTPSKSPDLNLDGAEAPMAEPATPSLP
WWSSEPTAWVSSPAPGEASGAVSPLDLPIAAMLRAPHAWPQPISSSAKATGVEGQGQAAS
IAPATPRPPPQLAEHGGGTSATTPEPPAPGLGEAGGPGSPQPGQAEHPSAGPRPSEAWNA
ADLISTEDTPDAEAGVPPTAEHPTSGLQGSEALKLGAQLDTSTLSTPSGGTRVPSSLHPW
GALYGHSSGGPLGSLVTPNPIGLGGTWEPGSHMLGGAGPVDTSAETPPTSPDLGAGVSVP
DPPSPASTGIQPHPGTEAQGLTRGPGPPSPSGGTVDEPASAAGESAPWGAXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXPTDPCENNPCLHGGSCS
ANSSTYGCSCAQGFAGENCEIXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXLCGPPPVLENASVVGARKAKYSVHATVRYQCHEGFSQQRADAIRCRASGTW
DPPRILCVRPRRSHRIRRHRRHHPHHHQRRHHRSHKERRKHRLHPAEDDQEGGNFC
Download sequence
Identical sequences ENSDORP00000013056 ENSDORP00000013056

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]