SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSDORP00000013087 from Dipodomys ordii 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSDORP00000013087
Domain Number 1 Region: 921-1043
Classification Level Classification E-value
Superfamily Ankyrin repeat 3.73e-26
Family Ankyrin repeat 0.000000224
Further Details:      
 
Domain Number 2 Region: 1-81
Classification Level Classification E-value
Superfamily Ubiquitin-like 6.72e-23
Family Ras-binding domain, RBD 0.03
Further Details:      
 
Domain Number 3 Region: 1050-1110
Classification Level Classification E-value
Superfamily SH3-domain 3.02e-16
Family SH3-domain 0.0000415
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSDORP00000013087   Gene: ENSDORG00000013922   Transcript: ENSDORT00000013922
Sequence length 1119
Comment pep:novel genescaffold:dipOrd1:GeneScaffold_4565:84842:114857:-1 gene:ENSDORG00000013922 transcript:ENSDORT00000013922 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MFLTVYLSNNEQHFTEVPVTPETICRDVVDLCKEPGESDCHLAEVWCGSERPVDDNERMF
DVLQRLGSQRNEVRFFLRHECPPIRDTVSGPRSQDPNLKRNGVKITGEHRRKENGXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXEEIEQMNSLFQQKQRELVLAVSKVEELTRQLE
MLKNGRIDGHHDNQSAVAELDRLYKELQLRNKLNQEQNAKLQQQRECLNKRNSEVAIMDK
RVNELRDRLWKKKAALQQRENLPXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXSKIHPGGPDWSPSNADLFPS
QAAPVPQSAGNALDQVDDGEVPLREKEKKVRPFSMFDTVDQCAAPSSFGTLRKNQSSEDI
LRDAQAANKNVAKVPVPTKPKQINLLYGQTNQPPLDIKLDGNPQQLPTVLTSMGNKPKPA
AGQQPRVLLSPSTPAGQDQTLSPGSKQESPPAAAVRPFTPQPSKDALLPAFRKPQTVAAS
SIYSMYTQHQAPGKNFQQAVQSALTKTQSRGPHFASVYGKPVIAAVQNPQQHPENIYSNC
QGKPGSPEPETEPVSSVHENHENERIPRPLSPTKLLPFLSNPYRNQSDADLEALRKKLSN
APRPLKKRSSITEPEGPNGPNIQKLLYQRTTIAAMETISVPSKSSTSVTVSPESPVDIAN
PYLHGEPEKEVVSLAAESLPPEEVGSSSTENSDMPAPSPGLDYVPEGVPEISSNLQNNAE
EANPEAPHLLEVYLEEYPPYPPPPYPSGEPEVPEEDSVRMRPPEITGQVSLPPGKRTNLR
KAGSERIAHGMRVKFNPLALLLDSSLEGEFDLVQRIIYEVDDPSLPNDEGITALHNAVCA
GHTEIVKFLVQFGVNVNAADSDGWTPLHCAASCNNVQVCKFLVESGAAVFAMTYSDMQTA
ADKCEEMEEGYTQCSQFLYGVQEKMGIMNKGVIYALWDYEPQNDDELLLKEGDCMTIVRR
EDEDEIEWWWARLNDKEGYVPRNLLGLYPRIKPRQRSLA
Download sequence
Identical sequences ENSDORP00000013087 ENSDORP00000013087

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]