SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSDORP00000013121 from Dipodomys ordii 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSDORP00000013121
Domain Number 1 Region: 6-50,93-145
Classification Level Classification E-value
Superfamily Ankyrin repeat 0.0000000323
Family Ankyrin repeat 0.013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSDORP00000013121   Gene: ENSDORG00000013958   Transcript: ENSDORT00000013958
Sequence length 731
Comment pep:novel genescaffold:dipOrd1:GeneScaffold_3646:5967:31237:1 gene:ENSDORG00000013958 transcript:ENSDORT00000013958 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
DYYMVKKILEENSSGDLNINCVDVLGRNAVTITIENENLDILQLLLDYGCQXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXKLMERIQNPEYSTTMDVAPVILAAHRNNYEILTML
LKQDVSLPKPHAVGCECTLCSAKNKKDSLRHSRFRLDIYRCLASPALIMLTEEDPILRAF
ELSADLKELSLVEVEFRNDYEELARQCKMFAKDLLAQARNSRELEVILNHTSSDEPLDKR
GLLEERMNLSRLKLAIKYNQKEFVSQSNCQQFLNTVWFGQMSGYRRKPTCKMTVLMVGIF
WPLSLCYLIAPSQFGRIIHTPFMKXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXMIWSDIKRLWYEGLEDFLEESRNQLSFVMNSLYLATFALKVVAHNKXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXEWRN
LKQKRDENYQKVMCCLVHRYLTSMRQRMQSTDQATVENLNELRQDLSKFRNEIRDLLGFR
TSKYAMFYPRN
Download sequence
Identical sequences ENSDORP00000013121 ENSDORP00000013121

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]