SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSDORP00000013147 from Dipodomys ordii 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSDORP00000013147
Domain Number 1 Region: 339-392
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00000000000000394
Family Classic zinc finger, C2H2 0.041
Further Details:      
 
Domain Number 2 Region: 297-326
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00000000000069
Family Classic zinc finger, C2H2 0.0081
Further Details:      
 
Domain Number 3 Region: 380-434
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00000000107
Family Classic zinc finger, C2H2 0.012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSDORP00000013147   Gene: ENSDORG00000013985   Transcript: ENSDORT00000013985
Sequence length 556
Comment pep:novel genescaffold:dipOrd1:GeneScaffold_1671:57471:77260:1 gene:ENSDORG00000013985 transcript:ENSDORT00000013985 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
AAHAVPEESQPRPEEKTAVAAVTPSGTMSCRVLRGGRDRGRAAAAAAAAAAAAAAVSRRR
KAEYPRRRRSSPSARPPDGPGQPAQAAKPPSPVQGKKSPRLQCIEKITGKDPKEEKEDKS
ILPQEVSTATTRPSRGWRSSSRTSVSRLRDTENTRSSRSKTGSLQLICKSEPITDQLDYE
VSEEHQSPGGIXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXETPKPRRKSGKVK
EEKEKKEIKVEVEVEVKEEENEIREDEEPPRXXXXXXXXXXXXXXXXXXKKPPIQYVRCE
MEGCGTVLAHPRYLQHHIKYQHLLKKKYVCPHPSCGRLFRLQKQLLRHAKHHTDQRDYIC
EYCARAFKSSHNLAVHRMIHTGEKPLQCEICGFTCRQKASLNWHMKKHDADSFYQFSCNI
CGKKFEKKDSVVAHKAKSHPEVLIAEALAANAGALITSTDILGTNPESLAQPADSQGLSL
LPEPLGNSTAGECLLLEAEGMSKSYCSGTERVSLMADGKIFVGSGSGGGTEGLVMNSDIL
GATTEVLIEDSDSTGP
Download sequence
Identical sequences ENSDORP00000013147 ENSDORP00000013147

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]