SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSDORP00000013166 from Dipodomys ordii 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSDORP00000013166
Domain Number 1 Region: 61-170
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 4.32e-25
Family Spermadhesin, CUB domain 0.00059
Further Details:      
 
Domain Number 2 Region: 256-364
Classification Level Classification E-value
Superfamily Cystine-knot cytokines 1.07e-18
Family Platelet-derived growth factor-like 0.014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSDORP00000013166   Gene: ENSDORG00000014006   Transcript: ENSDORT00000014006
Sequence length 372
Comment pep:novel genescaffold:dipOrd1:GeneScaffold_5292:21334:129210:-1 gene:ENSDORG00000014006 transcript:ENSDORT00000014006 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MHRLILLCALVCANFCSQRDAGATAQSASLKALRKANLRRDEGNHLTDLYRRDETIQVTG
NGHVQSPRFPSSYPRNLLLTWRLHSQEKTRIQLTFDHQFGLEEAENEICRYDFVEVEDVS
ETSTVVRGRWCGHKEVPPRITSRTNQIKITFKSDDYFVAKPGFKIYYSFVKDFQPVAASE
NNWESVTSPISGVSYNSPSVTDPNLTADALDKTVAQFDTVEDVLKYFNPESWQEDLENLY
VDLPQYRGRLYYGRKSKVDLDRLNDDVKRYSCTPRNYSVNLREELKLSSVVFFPRCLLVQ
RCGGNCGCGTGANNWKSCTCNSGKTVKKYHEVLRFEPGLFKRRGRAKNMALVDIQLDHHE
RCDCICSSRPPR
Download sequence
Identical sequences ENSDORP00000013166 ENSDORP00000013166

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]