SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSDORP00000013169 from Dipodomys ordii 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSDORP00000013169
Domain Number 1 Region: 621-936
Classification Level Classification E-value
Superfamily Ribonuclease H-like 1.21e-25
Family Hermes transposase-like 0.002
Further Details:      
 
Domain Number 2 Region: 245-267,376-403
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0000000135
Family Classic zinc finger, C2H2 0.032
Further Details:      
 
Domain Number 3 Region: 136-199
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.000000091
Family Classic zinc finger, C2H2 0.03
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSDORP00000013169   Gene: ENSDORG00000014008   Transcript: ENSDORT00000014009
Sequence length 938
Comment pep:novel genescaffold:dipOrd1:GeneScaffold_4300:88568:162767:1 gene:ENSDORG00000014008 transcript:ENSDORT00000014009 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
ADGASTAGRKSTANRERLKRSQKSSKVEGPEPGPAEASLSAEQGTMTEVKVKTELPDDYI
QEVIWQGEAKEEKKAVSKDGTGDVPAEICVVIGGVRNQQTLDGKAPEGSLHGGSLRSRYS
GSWIFDQAMKYASGSYECGICGKKYKYYNCFQTHVRAHRDTEATSGEGASQSNNFRYTCD
ICGKKYKYYSCFQEHRDLHAVDVFSVEGAPENRADPFDQGVVATDEVKEEPPEPFQKIGP
KTGNYTCEFCGKQYKYYTPYQEHVALHAPISTAPGWEPPDDPDTGSECSHPEVTPSPRFV
AAKTQTNQSGKKAPASVVRCATLLHRTPPATQTQPFRTPNSGSPASKATAAESAFSRRVE
GKAQNHFEETNSSSQNSSEPYTCGACGIQFQFYNNLLEHMQSHAADNENNITSNQSRSPP
AIVEEKWKPQAQRNSANNXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXIRDSGDVHWVQVLSEFVMSEIRTV
YVTDCRVSTSFSKAGMCFRCSCALNSVVQSVLSKRTLQARSMHEVIELLNVCEDLAGSTG
LAKETFGSLEETSPPPCWNSVTDSLLLVHERYEQICEFYSRAKKMNLIQSLNKHLLSNLA
AILTPVKQAVIELSNESQPTLQLVLPTYVRLEKLFTAKANDAGTVSKLCHLFLEALKENF
KVHPAHKVAMILDPQQKLRPVPPYQHEEIIGKVCELINEVKESWTEEADFEPTAKKPRST
PGEHPTAQEDDRLGKNEVYDYLQEPLFQATPDLFQYWSCVTQKHTKLAKLAFWLLAVPAV
GARSGCVNMCEQALLIKRRRLLSPEDMNKLMFLKSNML
Download sequence
Identical sequences ENSDORP00000013169 ENSDORP00000013169

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]