SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSDORP00000013209 from Dipodomys ordii 69_1

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  ENSDORP00000013209
Domain Number - Region: 304-339
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0258
Family Classic zinc finger, C2H2 0.048
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSDORP00000013209   Gene: ENSDORG00000014049   Transcript: ENSDORT00000014049
Sequence length 568
Comment pep:novel scaffold:dipOrd1:scaffold_6770:6875:34131:-1 gene:ENSDORG00000014049 transcript:ENSDORT00000014049 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
DYTHSACRNTYQGFNGMDRDYGPGSYGGMDRDYGHGSYGGXXXXXXXXNQSGKGHHSGGG
GGSRFGPYESYDSRSSLGGRDLYRSGYGFNEPEQSRFGGSYGGRFESSYRNSLDSFGGRN
QGGSSWEAPYSRSKLRPGFMEDRGRENYSSYSSFSSPHMKPAPVGSRGRGTPAYPESTFG
SRNYDAFGGPSTGRGRGRGHMGDFGSIHRPGIVVDYQNKPTNVTVATARGIKRKMVQPFN
KPGGAFIKKPKLAKPMEKMSLSKSPTKDPKNEEEEKRRIEARREKQRRRREKNSEKYGDG
YRMAFTCSFCKFRTFEEKDIELHLESSSHKETLDHIQKQTKFDKIVMDFLHECMVNKFKK
TSIRKQQTNNQTEVVKIIEKDVMEGVTADDHMMKVETVHCSACSVYIPALHSSVQQHLKS
PDHIKGKQAYKEQIKRESVLTATSILNNPILKSRYERFVKGENPFEIQDQSQDQQIEGDE
EDEEKIDEPIEEEEDEEEAGEAEGVEEAEEAGEAEGAEGEGDAEGREEGGTEGGEDPEGE
VEGAGEAELDEAAAKEPVDFPVEQPEEN
Download sequence
Identical sequences ENSDORP00000013209 ENSDORP00000013209

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]