SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSDORP00000013246 from Dipodomys ordii 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSDORP00000013246
Domain Number 1 Region: 60-256
Classification Level Classification E-value
Superfamily vWA-like 2.64e-54
Family Integrin A (or I) domain 0.00022
Further Details:      
 
Domain Number 2 Region: 296-346
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000000519
Family EGF-type module 0.0095
Further Details:      
 
Domain Number 3 Region: 385-429
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000135
Family EGF-type module 0.013
Further Details:      
 
Domain Number 4 Region: 338-387
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000016
Family EGF-type module 0.0085
Further Details:      
 
Domain Number 5 Region: 256-304
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000321
Family EGF-type module 0.017
Further Details:      
 
Domain Number 6 Region: 435-473
Classification Level Classification E-value
Superfamily Chicken cartilage matrix protein 0.0000017
Family Chicken cartilage matrix protein 0.0036
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSDORP00000013246   Gene: ENSDORG00000014087   Transcript: ENSDORT00000014087
Sequence length 479
Comment pep:novel genescaffold:dipOrd1:GeneScaffold_5954:94701:115119:-1 gene:ENSDORG00000014087 transcript:ENSDORT00000014087 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSRLTPVCYLRGLLLLWSLLLLPSAAPGPLDRPGIRIRRPEIRGPGGSPGRSPAPTSAPH
AGATQGPGVCKTRPLDLVFIIDSSRSVRPLEFTKVKTFVSRIIDTLDIGASDTRVAVVNY
ASTVKIEFQLQTYSDKRSLKQAVARVRPLSTGTMSGLAIQTAMDEAFTVAAGARGPGSNI
PKVAIIVTDGRPQDQVNEVAARARASGIELYAVGVDRADLESLRMMASEPLDEHVFYVET
YGVIEKLSSRFQETFCAVDPCVLGTHQCQHVCISDGDGKHHCECSQGYTLNVDRKTCSAI
DKCALSTHGCEHICVNERSGSYHCECHEGYALNADRKTCSAQDKCALGTVGCQHICVNDG
AGDYHCECFEGYSLNADKKTCSVDNKCVLGTHGCQHICVSDGVASYHCDCFPGYILNEDK
TTCSAVEEARSLISTEDSCGCEATVAFQEKVSSYLQRLNTKLDDILEKLQVNEYGQVHR
Download sequence
Identical sequences ENSDORP00000013246 ENSDORP00000013246

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]