SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSDORP00000013387 from Dipodomys ordii 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSDORP00000013387
Domain Number 1 Region: 577-629
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 4.41e-17
Family Classic zinc finger, C2H2 0.012
Further Details:      
 
Domain Number 2 Region: 614-666
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0000000000000675
Family Classic zinc finger, C2H2 0.01
Further Details:      
 
Domain Number 3 Region: 64-168
Classification Level Classification E-value
Superfamily SET domain 0.000000000801
Family Histone lysine methyltransferases 0.06
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSDORP00000013387   Gene: ENSDORG00000014237   Transcript: ENSDORT00000014236
Sequence length 786
Comment pep:novel genescaffold:dipOrd1:GeneScaffold_357:91391:110995:1 gene:ENSDORG00000014237 transcript:ENSDORT00000014236 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MKMDMKDADMTQWTEAEFELNCTYIVNDHPWDSGSEGGTPVQAKASLPRNLLFKYATDSK
EIIGVLSKEYIPQGTRFGPLVGEIYTSETVPKNANRKYFWRIYSRGELHHFIDGFNEEKS
NWMRYVNPAHYAQEQSLAACQNGMNIYFYTIKPIPANQELLVWYCRDFAERLHYPYPGEL
TGMNLTPTHSNPKQAGADTNELCPKNVPKREYSVKEILKMDSNPSKGKDLYPSNISPFTP
EKDLDDFRKVRSPLYPRVVYPIRAPLPEDFLKASLAYGMERPTYITHSPLPSSTTPSPSA
RSSPEQSLKSSSPHSSPGTTVSPVAPGSQEHRDSYTXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXLQKHYLVHTGEKPHECQVCHKR
FSSTSNLKTHLRLHSGEKPYQCKVCPAKFTQFVHLKLHKRLHTRERPHKCAQCHKSYIHL
CSLQVHLKGNCPVAPASGLTMDNLTRINEEIEKFDISDNADRLEDMEDSLDLTSVVEKEI
LAVVRKEKEETDLKVALQRNLGSGLLSSGCGLYESPDLSLMKLPRSKPLPLVPVKVKQET
VEPMDP
Download sequence
Identical sequences ENSDORP00000013387 ENSDORP00000013387

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]