SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSDORP00000013400 from Dipodomys ordii 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSDORP00000013400
Domain Number 1 Region: 48-137
Classification Level Classification E-value
Superfamily Retrovirus capsid dimerization domain-like 1.97e-37
Family SCAN domain 0.0000532
Further Details:      
 
Domain Number 2 Region: 357-414
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 4.98e-26
Family Classic zinc finger, C2H2 0.0032
Further Details:      
 
Domain Number 3 Region: 403-455
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 2.42e-19
Family Classic zinc finger, C2H2 0.0034
Further Details:      
 
Domain Number 4 Region: 485-535
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 8.92e-18
Family Classic zinc finger, C2H2 0.0068
Further Details:      
 
Domain Number 5 Region: 319-371
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.04e-16
Family Classic zinc finger, C2H2 0.0052
Further Details:      
 
Domain Number 6 Region: 216-264
Classification Level Classification E-value
Superfamily KRAB domain (Kruppel-associated box) 0.00000445
Family KRAB domain (Kruppel-associated box) 0.0089
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSDORP00000013400   Gene: ENSDORG00000014249   Transcript: ENSDORT00000014249
Sequence length 543
Comment pep:novel scaffold:dipOrd1:scaffold_5126:10043:16563:-1 gene:ENSDORG00000014249 transcript:ENSDORT00000014249 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAGEPGRHTALDAHSSEDQMELLTVKVEKEEFSALAADSGTPCSRVRGPECSRQRFRAFG
YPETAGPREALSQLRELCRQWLRPDLRSKEQILELLVLEQFLTILPGDLQGWVREQHPES
GEEVVLLLEYLERQLDEPMPQVLTGDLRQEPLCCKVALLTPAGRSQSSQLQPMRTLFKHE
SLGLQPLEERVPQVPGLAQRGSYREDATGVSRSTLQAQGLLKMEDVALSLSSGWMWQDSS
QMNLLRDARQENCGSLVSQGQEMQIKTSVETAVREYSEQERRQIPRCEGEDIPQAPPDAK
AGEHESKLQRKQKSATENRRHHCCDCGKSFAQSSGLSKHRRIHTGEKPYECEDCGKTFIG
SSALVIHQRVHTGEKPYECEECGKVFSHSSNLIKHQRTHTGEKPYECDDCGKTFSQSCSL
LEHHKIHTGEKPYPCTMCGKAFRRNSHLLRHQRIHTGARHVREPDWEGEGRLEGQWENTE
TPVSYKCSECERSFTRNRSLIEHLKIHTGEKPYQCDTCGKGFTRTSYLAQHQRSHVGKKL
LSQ
Download sequence
Identical sequences ENSDORP00000013400 ENSDORP00000013400

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]