SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSDORP00000013401 from Dipodomys ordii 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSDORP00000013401
Domain Number 1 Region: 126-183
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 2.12e-23
Family Classic zinc finger, C2H2 0.0037
Further Details:      
 
Domain Number 2 Region: 168-215
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 3.38e-16
Family Classic zinc finger, C2H2 0.0068
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSDORP00000013401   Gene: ENSDORG00000014250   Transcript: ENSDORT00000014250
Sequence length 231
Comment pep:novel scaffold:dipOrd1:scaffold_5126:30228:33403:1 gene:ENSDORG00000014250 transcript:ENSDORT00000014250 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
TASLKVVLEQRVLPDCEVQKPKKEKGEETRTENMKLVAVTESCERVEPCRKIPDFMETHH
VVINLEKQQNNPQGTADYKCSGLTESASPHPGGKHCESEVCQSSVTTCQEMFSREKGHQC
QECGKVFQRSSHLIRHQKIHLGEKPYQCKECGKVFSQNTGLLEHLRIHTGEKPYLCIHCG
KNFRRSSHLNRHQRIHSQEEPCECKECGKTFSKALLLTHYQRIHSHSKSHR
Download sequence
Identical sequences ENSDORP00000013401 ENSDORP00000013401

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]