SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSDORP00000013402 from Dipodomys ordii 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSDORP00000013402
Domain Number 1 Region: 38-123
Classification Level Classification E-value
Superfamily Retrovirus capsid dimerization domain-like 6.41e-37
Family SCAN domain 0.0000318
Further Details:      
 
Weak hits

Sequence:  ENSDORP00000013402
Domain Number - Region: 212-248
Classification Level Classification E-value
Superfamily KRAB domain (Kruppel-associated box) 0.00034
Family KRAB domain (Kruppel-associated box) 0.0087
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSDORP00000013402   Gene: ENSDORG00000014251   Transcript: ENSDORT00000014251
Sequence length 796
Comment pep:novel scaffold:dipOrd1:scaffold_5126:36980:47709:1 gene:ENSDORG00000014251 transcript:ENSDORT00000014251 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MFEDLPDSTCENEDNLVKVKAEDSSWEQAYHSQESSTHTQELCRLRFRQFCYQEASGPRE
ALAQLRELCHQWLRPEMHTKEQIMELLVLEQFLTILPKELQAWVQMDCLQSGEQAVTVLE
NLATGQAHTGQASFYIQGQDMHLVVAEYQGASLECQSLHILPGITTLTCEPPQLPQEVNG
ITPQGTTFAQRSSRDAALTEFXXXXXXMSAQTGEEAPQAFAPEEWPRLSLTQRHLYGNSA
QEKVASLMTEVITKDSLLNIEQDASEEMEQGEKTSGSPSRDCTPHIPCSTTEKTVSNVNT
LKDRHPPRDSWARMHIASLQYAAGDITRKGRKKDKARVSELLQGLAFSDDSEVEEEIEPE
LQPLQKKLKVSSVSEKSWTKRDLKSNFPSWSALDSGLLNLKSEKLNPVELFELFFDDETF
NLIVNETNNYASQKNVNLEVTVQEMRCVFGVLLWSGFVRRPRRGLYWEISDADQNLVRDA
IRRERFELIFSYLHFADNSHLDQKDKFSKLRPLIKQMNKNFLLYAPLEEYYCFDKSMCEC
FDSDQFLNGKPLRIGYKIWCGTTTQGYLVWFEPYQEESTMETDKDLDLGLGGNLVMNFAD
VLLERGQYPYHLCFDSFFTSVKLMSALKKKGVRATGSIRENRTEKCPLMNAEHMKKMKRG
YFDFRVEESDEIILCRWHGDGIISLCSNAVGIEPVNEISCFADGEEIPQVSQPSIVKLYE
ECRKGVGKMDQIISKYRVRLRSKKWYSILVSYMVDVAMNNAWQLHRICNPGSSLDLLDFR
RCVAHFYLGHNINLSN
Download sequence
Identical sequences ENSDORP00000013402 ENSDORP00000013402

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]