SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSDORP00000013447 from Dipodomys ordii 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSDORP00000013447
Domain Number 1 Region: 561-612
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00000000000063
Family Classic zinc finger, C2H2 0.0089
Further Details:      
 
Domain Number 2 Region: 450-504
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0000000000115
Family Classic zinc finger, C2H2 0.011
Further Details:      
 
Domain Number 3 Region: 519-575
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0000000000195
Family Classic zinc finger, C2H2 0.051
Further Details:      
 
Weak hits

Sequence:  ENSDORP00000013447
Domain Number - Region: 267-299
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.000111
Family Classic zinc finger, C2H2 0.038
Further Details:      
 
Domain Number - Region: 614-679
Classification Level Classification E-value
Superfamily Expressed protein At2g23090/F21P24.15 0.00115
Family Expressed protein At2g23090/F21P24.15 0.011
Further Details:      
 
Domain Number - Region: 692-713
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0059
Family Classic zinc finger, C2H2 0.032
Further Details:      
 
Domain Number - Region: 216-257
Classification Level Classification E-value
Superfamily SET domain 0.0252
Family Histone lysine methyltransferases 0.084
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSDORP00000013447   Gene: ENSDORG00000014292   Transcript: ENSDORT00000014297
Sequence length 1086
Comment pep:novel genescaffold:dipOrd1:GeneScaffold_5237:46256:105740:-1 gene:ENSDORG00000014292 transcript:ENSDORT00000014297 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
TLFTDPSQVAYVQQDVTAQQVLLPAHCQVLPSIESVDGSDPLVTXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXCEECNNAHSSVCPKHGXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXLHENLWFDLSDETLCNWMMFVRPAHNHLEQNLVAYQYGHHVYYTTIKNVEPK
QELKVWYAASYAEFVNQKIHDISEEERKVLREQEKNWPCYECNRRFISSEQLQQHLNSHD
EKLDVFSXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXFQNAALQHLFIRKSFRPFKCLQCGKAFREKDKLDQHLRFHGREGNC
PLTCDLCNKGFISSASLESHMKLHSDQKTYSCIFCPESFDRLDLLKDHVAIHINDGYFTC
PTCKKRFPDFIQVKKHVRSFHSEKIYQCTECDKAFCRPDKLRLHMLRHSDRKDFLCSTCG
KQFKRKDKLREHMQRMHNPEREAKKADRISRSKTFKPRITSTDYDSFTFKCRLCMMGFRR
RGMLVNHLSKRHPDMKIEEVPELTLPIIKPNRDYFCQYCDKVYKSASKRKAHILKNHPGA
ELPPSIRKLRPAGPGEPDPMLSTHTQLTGTIATPPVCCPHCKQYSSKXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXTTDLLTQAMTELSQTLTTDYRTTQG
DYQRIQYIPVSQSASGLQQPQHIQLQVVQVAPASSPHQSQQSTVDVGQLHDPQTYTQHAI
QVQHIQVTEPATTTPPSSQVAGQPLSPSAQPAQQGLSPSHIQGSSSTPGQALQQPQQQQP
QPQQQNTSVQHTYLPNAWNSFRGYSSEIQMMTLPPGQFVITDSGVATPVTSGQVKAVTPG
HYVLSESQPELEEKQTAALSATVQVQPSTHSDSLDSQNSSQQQTTQYIITTTTNGNGSSE
VHITKP
Download sequence
Identical sequences ENSDORP00000013447 ENSDORP00000013447

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]